Recombinant Human H2AFZ

• Cat.No.: H2AFZ-29178TH
• Product Overview: Recombinant full length protein of Human H2A.Z with proprietary tag; predicted MW 40.19 kDa, inclusive of tag.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.
• Protein length: 128 amino acids
• Molecular Weight: 40.190kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSR TTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK RITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV
• Sequence Similarities: Belongs to the histone H2A family.

Gene Information

• Gene Name: H2AFZ H2A histone family, member Z [ Homo sapiens ]
• Official Symbol: H2AFZ
• Synonyms: H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z
• Gene ID: 3015
• mRNA Refseq: NM_002106
• Protein Refseq: NP_002097
• MIM: 142763
• Uniprot ID: P0C0S5
• Chromosome Location: 4q23
• Pathway: Amyloids, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; Meiosis, organism-specific biosystem
• Function: DNA binding