Recombinant Human HAUS1, His-tagged
Cat.No. : | HAUS1-26321TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-278 of Human CCDC5 with N terminal His tag, 34kDa. |
- Specification
- Gene Information
- Related Products
Description : | HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb augmentare, meaning to increase. The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. Expressed in pancreas, kidney, skeletal muscle, liver and heart. Weakly expressed in lung, brain and placenta. |
Form : | Lyophilised:Reconstitute with 63 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHL SERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLME SVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPA VNDLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKC LQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRF GIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPL KKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRR VDMMEL |
Sequence Similarities : | Belongs to the HAUS1 family. |
Gene Name : | HAUS1 HAUS augmin-like complex, subunit 1 [ Homo sapiens ] |
Official Symbol : | HAUS1 |
Synonyms : | HAUS1; HAUS augmin-like complex, subunit 1; CCDC5, coiled coil domain containing 5 (spindle associated); HAUS augmin-like complex subunit 1; FLJ40084; HEI C; HsT1461; |
Gene ID : | 115106 |
mRNA Refseq : | NM_138443 |
Protein Refseq : | NP_612452 |
MIM : | 608775 |
Uniprot ID : | Q96CS2 |
Chromosome Location : | 18q21.1 |
Function : | molecular_function; |
Products Types
◆ Recombinant Protein | ||
HAUS1-4063M | Recombinant Mouse HAUS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Haus1-3358M | Recombinant Mouse Haus1 Protein, Myc/DDK-tagged | +Inquiry |
HAUS1-2448R | Recombinant Rat HAUS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAUS1-3097H | Recombinant Human HAUS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAUS1-5209H | Recombinant Human HAUS1 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
HAUS1-5630HCL | Recombinant Human HAUS1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All HAUS1 Products
Required fields are marked with *
My Review for All HAUS1 Products
Required fields are marked with *
0
Inquiry Basket