Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human HIP1R, His-tagged

Cat.No. : HIP1R-29320TH
Product Overview : Recombinant fragment, corresponding to amino acids 729-876 of Human HIP1R with a N terminal His tag; Pred MWt 17kDa:
  • Specification
  • Gene Information
  • Related Products
Description : Huntingtin-interacting protein 1-related protein is a protein that in humans is encoded by the HIP1R gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 99 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELK PKSLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMN QARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSL QKEIVESGRGAATQQEFYAKNSRWTEGLISAS
Gene Name : HIP1R huntingtin interacting protein 1 related [ Homo sapiens ]
Official Symbol : HIP1R
Synonyms : HIP1R; huntingtin interacting protein 1 related; huntingtin-interacting protein 1-related protein; FLJ14000; HIP3; HIP12; ILWEQ; KIAA0655;
Gene ID : 9026
mRNA Refseq : NM_003959
Protein Refseq : NP_003950
MIM : 605613
Uniprot ID : O75146
Chromosome Location : 12q24
Pathway : Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function : actin binding; phosphatidylinositol binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All HIP1R Products

Required fields are marked with *

My Review for All HIP1R Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends