Recombinant Human HSP90B1, His-tagged
Cat.No. : | HSP90B1-27413TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 341-803 of Human GRP94 with N terminal His tag; 463 amino acids, 57kDa. |
- Specification
- Gene Information
- Related Products
Description : | HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. HSP90B1 is an endoplasmic reticulum HSP90 protein. Other HSP90 proteins are found in cytosol (see HSP90AA1; MIM 140571) and mitochondria (TRAP1; MIM 606219) (Chen et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | PIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGE VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFI TDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLK VIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGV IEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEK QDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDE YCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVE KEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVAS QYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPR HPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYL LPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEET AEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL |
Sequence Similarities : | Belongs to the heat shock protein 90 family. |
Gene Name : | HSP90B1 heat shock protein 90kDa beta (Grp94), member 1 [ Homo sapiens ] |
Official Symbol : | HSP90B1 |
Synonyms : | HSP90B1; heat shock protein 90kDa beta (Grp94), member 1; TRA1, tumor rejection antigen (gp96) 1; endoplasmin; GP96; GRP94; |
Gene ID : | 7184 |
mRNA Refseq : | NM_003299 |
Protein Refseq : | NP_003290 |
MIM : | 191175 |
Uniprot ID : | P14625 |
Chromosome Location : | 12q24.2-q24.3 |
Pathway : | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; IL6-mediated signaling events, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem; |
Function : | ATP binding; RNA binding; calcium ion binding; low-density lipoprotein particle receptor binding; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
HSP90B1-2652H | Recombinant Human HSP90B1 protein(51-610 aa), C-His-tagged | +Inquiry |
HSP90B1-1115H | Recombinant Human HSP90B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSP90B1-2259H | Recombinant Human HSP90B1 Protein, His-tagged | +Inquiry |
HSP90B1-351C | Recombinant Cynomolgus Monkey HSP90B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSP90B1-2596R | Recombinant Rat HSP90B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
HSP90B1-5360HCL | Recombinant Human HSP90B1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionHSP90B1 interacts with various proteins and participates in complex cellular processes, including protein folding, quality control, and antigen presentation.
It's possible. You may want to check the latest clinical trial databases for the most up-to-date information.
Yes, the expression of HSP90B1 can vary among tissues, reflecting its diverse functions in different cellular environments.
Research suggests that HSP90B1 levels may be altered in some diseases, making it a potential diagnostic marker, but more studies are needed for validation.
Mutations in HSP90B1 have been associated with certain diseases, highlighting the importance of its proper function for cellular health.
Customer Reviews (3)
Write a reviewTheir in-depth understanding of the protein's characteristics, applications, and potential limitations allows for valuable insights and recommendations, ensuring the success of my experiments.
Whether it's troubleshooting, protocol optimization, or general inquiries, their knowledgeable and responsive team is readily available to assist and solve any problems that may arise during the experimental process.
Its purity, integrity, and consistency ensure reliable and reproducible results, which are essential for meaningful scientific discoveries.
Ask a Question for All HSP90B1 Products
Required fields are marked with *
My Review for All HSP90B1 Products
Required fields are marked with *
Inquiry Basket