Recombinant Human IL12RB2
Cat.No. : | IL12RB2-29640TH |
Product Overview : | Recombinant fragment of Human IL12RB2 with an N-terminal proprietary tag; Predicted MW 37.73 kDa |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohns disease and leprosy, which is thought to contribute to the inflammatory response and host defense. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa |
Source : | Wheat germ |
Tissue specificity : | Isoform 2 is expressed at similar levels in both naive and activated T-cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS |
Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains. |
Gene Name : | IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ] |
Official Symbol : | IL12RB2 |
Synonyms : | IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2; |
Gene ID : | 3595 |
mRNA Refseq : | NM_001559 |
Protein Refseq : | NP_001550 |
MIM : | 601642 |
Uniprot ID : | Q99665 |
Chromosome Location : | 1p31.3-p31.2 |
Pathway : | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; |
Function : | cytokine receptor activity; protein kinase binding; receptor activity; |
Products Types
◆ Recombinant Protein | ||
IL12RB2-214H | Recombinant Human IL12RB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL12RB2-3230H | Recombinant Human IL12RB2 Protein, His-tagged | +Inquiry |
IL12RB2-3885H | Recombinant Human IL12RB2 protein, His-tagged | +Inquiry |
IL12RB2-73H | Recombinant Human IL12RB2 protein, Fc-tagged | +Inquiry |
IL12RB2-9483H | Active Recombinant Human IL12RB2 Protein, Fc/His-tagged | +Inquiry |
◆ Lysates | ||
IL12RB2-2142MCL | Recombinant Mouse IL12RB2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket