Recombinant Human IL12RB2

• Cat.No.: IL12RB2-29640TH
• Product Overview: Recombinant fragment of Human IL12RB2 with an N-terminal proprietary tag; Predicted MW 37.73 kDa

Specification

• Description: The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohns disease and leprosy, which is thought to contribute to the inflammatory response and host defense.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa
• Source: Wheat germ
• Tissue specificity: Isoform 2 is expressed at similar levels in both naive and activated T-cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS
• Sequence Similarities: Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.

Gene Information

• Gene Name: IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ]
• Official Symbol: IL12RB2
• Synonyms: IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2
• Gene ID: 3595
• mRNA Refseq: NM_001559
• Protein Refseq: NP_001550
• MIM: 601642
• Uniprot ID: Q99665
• Chromosome Location: 1p31.3-p31.2
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem
• Function: cytokine receptor activity; protein kinase binding; receptor activity