Recombinant Human ITGB7
| Cat.No. : | ITGB7-26863TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 401-505 of Human Integrin beta 7 with an N terminl proproetary tag; predicted mwt: 37.18 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | Integrin beta-7 is a protein that in humans is encoded by the ITGB7 gene. |
| Protein length : | 105 amino acids |
| Molecular Weight : | 37.180kDa |
| Source : | Wheat germ |
| Tissue specificity : | Expressed in a variety of leukocyte lines. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.03% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFW VSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD TQPQAPHCSDGQGHLQCGVCSCAPG |
| Sequence Similarities : | Belongs to the integrin beta chain family.Contains 1 VWFA domain. |
| Gene Name : | ITGB7 integrin, beta 7 [ Homo sapiens ] |
| Official Symbol : | ITGB7 |
| Synonyms : | ITGB7; integrin, beta 7; integrin beta-7; |
| Gene ID : | 3695 |
| mRNA Refseq : | NM_000889 |
| Protein Refseq : | NP_000880 |
| MIM : | 147559 |
| Uniprot ID : | P26010 |
| Chromosome Location : | 12q13.1 |
| Pathway : | Adaptive Immune System, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
| Function : | binding; metal ion binding; receptor activity; |
Products Types
| ◆ Recombinant Protein | ||
| ITGB7-4966H | Recombinant Human ITGB7 Protein, GST-tagged | +Inquiry |
| Itgb7-3611M | Recombinant Mouse Itgb7 Protein, Myc/DDK-tagged | +Inquiry |
| ITGB7-4647M | Recombinant Mouse ITGB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITGB7-1218H | Recombinant Human ITGB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITGB7-8371M | Recombinant Mouse ITGB7 Protein | +Inquiry |
| ◆ Lysates | ||
| ITGB7-5121HCL | Recombinant Human ITGB7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
