Recombinant Human KLC1, His-tagged
Cat.No. : | KLC1-27879TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 301-578 of Human Kinesin 2, with an N terminal His tag; MWt 32kDa. |
- Specification
- Gene Information
- Related Products
Description : | Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named "kinesin 2", this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Found in a variety of tissues. Mostly abundant in brain and spine. |
Form : | Lyophilised:Reconstitute with 54 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAK QLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDP NVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREF GSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYK ACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSR KQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKY ESGPDGGEEVSMSVEWNGDGTGSLKRSGSFSKLRASIR RSSEKLVR |
Sequence Similarities : | Belongs to the kinesin light chain family.Contains 6 TPR repeats. |
Gene Name : | KLC1 kinesin light chain 1 [ Homo sapiens ] |
Official Symbol : | KLC1 |
Synonyms : | KLC1; kinesin light chain 1; kinesin 2 , kinesin 2 60/70kDa , KNS2; hKLC1B; hKLC1G; hKLC1J; hKLC1N; hKLC1P; hKLC1R; hKLC1S; KLC; KNS2A; |
Gene ID : | 3831 |
mRNA Refseq : | NM_001130107 |
Protein Refseq : | NP_001123579 |
MIM : | 600025 |
Uniprot ID : | Q07866 |
Chromosome Location : | 14q32.3 |
Pathway : | Arf6 trafficking events, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Kinesins, organism-specific biosystem; Salmonella infection, organism-specific biosystem; |
Function : | microtubule motor activity; motor activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
KLC1-2923R | Recombinant Rat KLC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLC1-2736H | Recombinant Human KLC1 Protein (Met1-Val254), N-His tagged | +Inquiry |
KLC1-3267R | Recombinant Rat KLC1 Protein | +Inquiry |
KLC1-7881H | Recombinant Human KLC1 protein, His & T7-tagged | +Inquiry |
KLC1-5849H | Recombinant Human KLC1 protein, GST-tagged | +Inquiry |
◆ Native Protein | ||
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
◆ Lysates | ||
KLC1-4935HCL | Recombinant Human KLC1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All KLC1 Products
Required fields are marked with *
My Review for All KLC1 Products
Required fields are marked with *
0
Inquiry Basket