Recombinant Human KLRD1

• Cat.No.: KLRD1-26330TH
• Product Overview: Recombinant full length Human CD94 with N-terminal proprietary tag. Predicted MW 45.1kDa.

Specification

• Description: Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene.
• Protein length: 179 amino acids
• Molecular Weight: 45.100kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Natural killer cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSI EPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQK TWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLS YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGN ALDESCEDKNRYICKQQLI
• Sequence Similarities: Contains 1 C-type lectin domain.

Gene Information

• Gene Name: KLRD1 killer cell lectin-like receptor subfamily D, member 1 [ Homo sapiens ]
• Official Symbol: KLRD1
• Synonyms: KLRD1; killer cell lectin-like receptor subfamily D, member 1; CD94; natural killer cells antigen CD94
• Gene ID: 3824
• mRNA Refseq: NM_001114396
• Protein Refseq: NP_001107868
• MIM: 602894
• Uniprot ID: Q13241
• Chromosome Location: 12p13
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Graft-versus-host disease, organism-specific biosystem; Graft-versus-host disease, conserved biosystem
• Function: binding; receptor activity; sugar binding; transmembrane signaling receptor activity