Recombinant Human LIFR

• Cat.No.: LIFR-28855TH
• Product Overview: Recombinant fragment of Human LIFR with N terminal proprietary tag, 37.73kDa.

Specification

• Description: This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIE NRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSK FTLNEQNVSLIPDTPEILNLSADFSTSTLY

Gene Information

• Gene Name: LIFR leukemia inhibitory factor receptor alpha [ Homo sapiens ]
• Official Symbol: LIFR
• Synonyms: LIFR; leukemia inhibitory factor receptor alpha; leukemia inhibitory factor receptor; CD118
• Gene ID: 3977
• mRNA Refseq: NM_001127671
• Protein Refseq: NP_001121143
• MIM: 151443
• Uniprot ID: P42702
• Chromosome Location: 5p13-p12
• Pathway: Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem
• Function: contributes_to ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; cytokine binding; growth factor binding; leukemia inhibitory factor receptor activity