Recombinant Human MAPK3
Cat.No. : | MAPK3-28699TH |
Product Overview : | Recombinant full length protein corresponding to amino acids 2-379 of Human ERK1, with an N-terminal proprietary tag; predicted MWt 69.8 kDa inclusive of tag.Residue A232 of the fusion protein is equivalent to A2 of the native enzyme. Protease cleavage si |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. |
Protein length : | 378 amino acids |
Molecular Weight : | 69.800kDa inclusive of tags |
Source : | E. coli |
Biological activity : | Specific activity: 379.25 units/ml;621.73 Units/mg |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 7.50Constituents:0.79% Tris HCl, 9.24% Sucrose, 0.88% Sodium chloride, 0.003% EGTA, 0.1% Beta mercaptoethanol, 0.002% Brij, 0.012% Benzamidine, 0.003% PMSF |
Storage : | Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDK WRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKV DFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSAAAAAQGGG GGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGE GAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQ ILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLY KLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPS NLLSNTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWY RAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHY LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV AWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYL EQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETAR FQPGVLEAP |
Sequence Similarities : | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain. |
Gene Name : | MAPK3 mitogen-activated protein kinase 3 [ Homo sapiens ] |
Official Symbol : | MAPK3 |
Synonyms : | MAPK3; mitogen-activated protein kinase 3; PRKM3; ERK1; p44erk1; p44mapk; |
Gene ID : | 5595 |
mRNA Refseq : | NM_001040056 |
Protein Refseq : | NP_001035145 |
MIM : | 601795 |
Uniprot ID : | P27361 |
Chromosome Location : | 16p11.2 |
Pathway : | ALK1 signaling events, organism-specific biosystem; ARMS-mediated activation, organism-specific biosystem; ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; |
Function : | ATP binding; MAP kinase activity; MAP kinase activity; nucleotide binding; phosphatase binding; |
Products Types
◆ Recombinant Protein | ||
MAPK3-1083H | Recombinant Human MAPK3 Protein (A2-P379), GST tagged | +Inquiry |
Mapk3-3942M | Recombinant Mouse Mapk3 Protein, Myc/DDK-tagged | +Inquiry |
MAPK3-5350M | Recombinant Mouse MAPK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPK3-1050H | Active Recombinant Human MAPK3 Protein, His/GST-Tagged | +Inquiry |
MAPK3-1082H | Recombinant Human MAPK3 Protein (A2-P379), Tag Free | +Inquiry |
◆ Lysates | ||
MAPK3-4494HCL | Recombinant Human MAPK3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionDysregulation of MAPK3 signaling has been implicated in the pathogenesis of several diseases. Aberrant activation of MAPK3 is associated with cancer development and progression, as it promotes cell proliferation and survival. MAPK3 signaling is also involved in cardiovascular diseases, contributing to vascular remodeling and hypertrophy. In neurodegenerative diseases, dysregulated MAPK3 activity contributes to neuronal dysfunction and apoptosis.
Future research in MAPK3 aims to elucidate the intricate signaling network and identify novel regulatory mechanisms. Understanding the crosstalk between MAPK3 and other signaling pathways will be crucial for developing targeted therapies. Additionally, exploring the role of MAPK3 isoforms in different cellular contexts and disease states will provide valuable insights. Furthermore, the development of more specific and potent inhibitors with reduced toxicity profiles is a focus for future therapeutic interventions.
MAPK3, also known as ERK1 (Extracellular Signal-Regulated Kinase 1), is a serine/threonine kinase involved in cell signaling pathways. It consists of 379 amino acids and exhibits a conserved catalytic domain. MAPK3 plays a crucial role in regulating cell proliferation, differentiation, and survival by phosphorylating downstream targets such as transcription factors and other kinases.
MAPK3 signaling exerts its effects through phosphorylation of downstream targets. It phosphorylates various transcription factors, including ELK1 and c-Fos, leading to changes in gene expression. MAPK3 also phosphorylates other kinases, such as p90RSK, which further propagate the signal to regulate cellular processes like cell cycle progression, apoptosis, and differentiation.
One challenge is the potential for off-target effects when targeting MAPK3, as it is involved in multiple signaling pathways. Additionally, resistance to MAPK3 inhibitors can emerge due to compensatory signaling mechanisms and genetic alterations. Another challenge lies in achieving selective inhibition of specific MAPK3 isoforms without affecting other closely related kinases.
The activity of MAPK3 is tightly regulated by various mechanisms. Activation of MAPK3 involves dual phosphorylation of threonine and tyrosine residues by upstream kinases. Conversely, dephosphorylation by phosphatases can inactivate MAPK3. Additionally, scaffolding proteins and interacting partners can modulate its activity by facilitating or inhibiting its phosphorylation or by regulating its subcellular localization.
Inhibition of MAPK3 activity or downstream effectors represents a potential therapeutic approach. Small molecule inhibitors targeting MAPK3 kinase activity, such as U0126 and PD98059, have been developed. Monoclonal antibodies against MAPK3 or its downstream effectors are also being investigated. Combination therapies targeting multiple components of the MAPK3 signaling pathway are being explored to enhance efficacy and overcome resistance.
Customer Reviews (3)
Write a reviewExemplary precision and unblemished dependability render it my most cherished research ally.
Presenting exceptional reliability and stability, the experimental reagent establishes a robust foundation for my experiments.
Exquisitely crafted packaging design adds convenience to the usage of this protein reagent and exudes a sense of sophistication.
Ask a Question for All MAPK3 Products
Required fields are marked with *
My Review for All MAPK3 Products
Required fields are marked with *
Inquiry Basket