Recombinant Human MBD3, His-tagged
Cat.No. : | MBD3-28525TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 164-291 of Human MBD3 with N terminal His tag; Predicted MWt 15 kDa. |
- Specification
- Gene Information
- Related Products
Description : | DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). However, unlike the other family members, MBD3 is not capable of binding to methylated DNA. The predicted MBD3 protein shares 71% and 94% identity with MBD2 (isoform 1) and mouse Mbd3.MBD3 is a subunit of the NuRD, a multisubunit complex containing nucleosome remodeling and histone deacetylase activities. MBD3 mediates the association of metastasis-associated protein 2 (MTA2) with the core histone deacetylase complex. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 86 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKN PGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEE ALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEE EEPDPDPEMEHV |
Sequence Similarities : | Contains 1 MBD (methyl-CpG-binding) domain. |
Gene Name : | MBD3 methyl-CpG binding domain protein 3 [ Homo sapiens ] |
Official Symbol : | MBD3 |
Synonyms : | MBD3; methyl-CpG binding domain protein 3; methyl-CpG-binding domain protein 3; |
Gene ID : | 53615 |
mRNA Refseq : | NM_003926 |
Protein Refseq : | NP_003917 |
MIM : | 603573 |
Uniprot ID : | O95983 |
Chromosome Location : | 19p13 |
Pathway : | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
Function : | DNA binding; chromatin binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
MBD3-2512R | Recombinant Rhesus Macaque MBD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MBD3-3583C | Recombinant Chicken MBD3 | +Inquiry |
MBD3-223H | Recombinant Human MBD3 protein, T7/His-tagged | +Inquiry |
MBD3-2692R | Recombinant Rhesus monkey MBD3 Protein, His-tagged | +Inquiry |
MBD3-7179H | Recombinant Human Methyl-CpG Binding Domain Protein 3, His-tagged | +Inquiry |
◆ Lysates | ||
MBD3-1065HCL | Recombinant Human MBD3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MBD3 Products
Required fields are marked with *
My Review for All MBD3 Products
Required fields are marked with *
0
Inquiry Basket