"MEIS1" Related Products

Recombinant Human MEIS1 protein, GST-tagged

Cat.No.: MEIS1-26868TH
Product Overview: Recombinant Human MEIS1(1 a.a. - 378 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 68.1 kDa
AA Sequence: MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDK DAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQ VLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRS GGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGKTL FLW
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: MEIS1 Meis homeobox 1 [ Homo sapiens ]
Official Symbol: MEIS1
Synonyms: MEIS1; Meis homeobox 1; Meis1 (mouse) homolog , Meis1, myeloid ecotropic viral integration site 1 homolog (mouse); homeobox protein Meis1; WUGSC:H_NH0444B04.1; leukemogenic homolog protein; Meis1, myeloid ecotropic viral integration site 1 homolog; MGC43380;
Gene ID: 4211
mRNA Refseq: NM_002398
Protein Refseq: NP_002389
MIM: 601739
UniProt ID: O00470
Chromosome Location: 2p14
Pathway: Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;
Function: protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.