Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human MGST1

Cat.No. : MGST1-30203TH
Product Overview : Recombinant full length Human Microsomal Glutathione S-transferase 1 with a N terminal proprietary tag; predicted MW: 42.79 kDa inclusive of tag. P10620, AAH05923.
  • Specification
  • Gene Information
  • Related Products
Description : The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform.
Protein length : 155 amino acids
Molecular Weight : 42.790kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLT RKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDL ENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
Sequence Similarities : Belongs to the MAPEG family.
Gene Name : MGST1 microsomal glutathione S-transferase 1 [ Homo sapiens ]
Official Symbol : MGST1
Synonyms : MGST1; microsomal glutathione S-transferase 1; GST12; MGST I;
Gene ID : 4257
mRNA Refseq : NM_020300
Protein Refseq : NP_064696
MIM : 138330
Uniprot ID : P10620
Chromosome Location : 12p12.3-p12.1
Pathway : Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem;
Function : glutathione binding; glutathione transferase activity; protein binding; protein homodimerization activity; transferase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends