Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human MMP12, His-tagged

Cat.No. : MMP12-28717TH
Product Overview : Recombinant fragment: MKFLLILLLQ ATASGALPLN SSTSLEKNNV LFG, corresponding to amino acids 1-33 of Human MMP12, fused at the N terminal to a His tag, 8kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Conjugation : HIS
Source : E. coli
Tissue specificity : Found in alveolar macrophages but not in peripheral blood monocytes.
Form : Liquid
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MKFLLILLLQATASGALPLNSSTSLEKNNVLFG
Sequence Similarities : Belongs to the peptidase M10A family.Contains 4 hemopexin-like domains.
Gene Name : MMP12 matrix metallopeptidase 12 (macrophage elastase) [ Homo sapiens ]
Official Symbol : MMP12
Synonyms : MMP12; matrix metallopeptidase 12 (macrophage elastase); matrix metalloproteinase 12 (macrophage elastase); macrophage metalloelastase; HME;
Gene ID : 4321
mRNA Refseq : NM_002426
Protein Refseq : NP_002417
MIM : 601046
Uniprot ID : P39900
Chromosome Location : 11q22.3
Pathway : Matrix Metalloproteinases, organism-specific biosystem;
Function : calcium ion binding; endopeptidase activity; metalloendopeptidase activity; peptidase activity; zinc ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All MMP12 Products

Required fields are marked with *

My Review for All MMP12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends