Recombinant Human MMP12, His-tagged
Cat.No. : | MMP12-28717TH |
Product Overview : | Recombinant fragment: MKFLLILLLQ ATASGALPLN SSTSLEKNNV LFG, corresponding to amino acids 1-33 of Human MMP12, fused at the N terminal to a His tag, 8kDa. |
- Specification
- Gene Information
- Related Products
Description : | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Found in alveolar macrophages but not in peripheral blood monocytes. |
Form : | Liquid |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKFLLILLLQATASGALPLNSSTSLEKNNVLFG |
Sequence Similarities : | Belongs to the peptidase M10A family.Contains 4 hemopexin-like domains. |
Gene Name : | MMP12 matrix metallopeptidase 12 (macrophage elastase) [ Homo sapiens ] |
Official Symbol : | MMP12 |
Synonyms : | MMP12; matrix metallopeptidase 12 (macrophage elastase); matrix metalloproteinase 12 (macrophage elastase); macrophage metalloelastase; HME; |
Gene ID : | 4321 |
mRNA Refseq : | NM_002426 |
Protein Refseq : | NP_002417 |
MIM : | 601046 |
Uniprot ID : | P39900 |
Chromosome Location : | 11q22.3 |
Pathway : | Matrix Metalloproteinases, organism-specific biosystem; |
Function : | calcium ion binding; endopeptidase activity; metalloendopeptidase activity; peptidase activity; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
Mmp12-10592M | Recombinant Mouse Mmp12 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP12-1283H | Recombinant Human MMP12 Protein, His-tagged | +Inquiry |
MMP12-1134H | Active Recombinant Human MMP12 Protein | +Inquiry |
MMP12-3368R | Recombinant Rat MMP12 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP12-5418H | Recombinant Human MMP12 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
MMP12-4281HCL | Recombinant Human MMP12 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MMP12 Products
Required fields are marked with *
My Review for All MMP12 Products
Required fields are marked with *
0
Inquiry Basket