Recombinant Human NANS
Cat.No. : | NANS-28782TH |
Product Overview : | Recombinant full length Human NANS expressed in Saccharomyces cerevisiae; amino acids 1-359 , 40.3kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Immunogen affinity purified |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMI RMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWG KTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDE MAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMV ISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPED VNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGA KVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVE RALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILT MDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEE LVDNHGKKIKS |
Sequence Similarities : | Contains 1 AFP-like domain. |
Gene Name : | NANS N-acetylneuraminic acid synthase [ Homo sapiens ] |
Official Symbol : | NANS |
Synonyms : | NANS; N-acetylneuraminic acid synthase; sialic acid synthase; SAS; |
Gene ID : | 54187 |
mRNA Refseq : | NM_018946 |
Protein Refseq : | NP_061819 |
MIM : | 605202 |
Uniprot ID : | Q9NR45 |
Chromosome Location : | 9p24.1-p23 |
Pathway : | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), conserved biosystem; Metabolic pathways, organism-specific biosystem; superpathway of sialic acid and CMP-sialic acid biosynthesis, conserved biosystem; |
Function : | N-acetylneuraminate synthase activity; N-acylneuraminate cytidylyltransferase activity; N-acylneuraminate-9-phosphate synthase activity; transferase activity; |
Products Types
◆ Recombinant Protein | ||
NANS-1477H | Recombinant Human NANS Protein, His (Fc)-Avi-tagged | +Inquiry |
Nans-4288M | Recombinant Mouse Nans Protein, Myc/DDK-tagged | +Inquiry |
NANS-4947H | Recombinant Human NANS Protein (Met1-Ser359), N-His tagged | +Inquiry |
NANS-1816C | Recombinant Chicken NANS | +Inquiry |
NANS-28783TH | Recombinant Human NANS, His-tagged | +Inquiry |
◆ Lysates | ||
NANS-3979HCL | Recombinant Human NANS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All NANS Products
Required fields are marked with *
My Review for All NANS Products
Required fields are marked with *
0
Inquiry Basket