Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human NOTCH1

Cat.No. : NOTCH1-29727TH
Product Overview : Recombinant fragment of Human Notch1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNP CLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPL DNACLTNPCRNGGTCDLLTLTEYKCRCPPG
Sequence Similarities : Belongs to the NOTCH family.Contains 5 ANK repeats.Contains 36 EGF-like domains.Contains 3 LNR (Lin/Notch) repeats.
Gene Name : NOTCH1 notch 1 [ Homo sapiens ]
Official Symbol : NOTCH1
Synonyms : NOTCH1; notch 1; Notch (Drosophila) homolog 1 (translocation associated) , Notch homolog 1, translocation associated (Drosophila) , TAN1; neurogenic locus notch homolog protein 1;
Gene ID : 4851
mRNA Refseq : NM_017617
Protein Refseq : NP_060087
MIM : 190198
Uniprot ID : P46531
Chromosome Location : 9q34.3
Pathway : A third proteolytic cleavage releases NICD, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Dorso-ventral axis formation, organism-specific biosystem; Dorso-ventral axis formation, conserved biosystem;
Function : calcium ion binding; chromatin DNA binding; core promoter binding; protein binding; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
How does NOTCH1 contribute to the regulation of embryonic development and tissue homeostasis? 09/22/2022

NOTCH1 contributes to the regulation of embryonic development and tissue homeostasis by influencing cell differentiation and proliferation.

What are the ligands or interacting partners of NOTCH1, and how do they regulate its activation? 09/22/2021

The ligands or interacting partners of NOTCH1 include Delta-like 1 (DLL1), Delta-like 3 (DLL3), Delta-like 4 (DLL4), Jagged 1, and Jagged 2, regulating its activation.

What is the primary function of Neurogenic locus notch homolog protein 1 (NOTCH1) in cellular processes and signaling? 06/02/2021

Neurogenic locus notch homolog protein 1 (NOTCH1) functions in cellular processes, primarily playing a role in the Notch signaling pathway.

What diseases or conditions are associated with dysregulation or abnormal expression of NOTCH1? 05/12/2021

Dysregulation or abnormal expression of NOTCH1 is associated with conditions such as cancer, cardiovascular diseases, and developmental disorders.

In which cellular compartments is NOTCH1 predominantly localized? 02/24/2018

NOTCH1 is predominantly localized on the cell membrane, where it undergoes proteolytic cleavage upon activation.

Are there therapeutic implications or potential targets related to NOTCH1 in diseases involving Notch signaling? 07/09/2017

There are potential therapeutic implications related to NOTCH1 in diseases involving Notch signaling, making it a target for drug development.

How does NOTCH1 participate in the Notch signaling pathway, and what is its role in cell fate determination? 09/12/2016

NOTCH1 participates in the Notch signaling pathway by interacting with ligands such as Delta and Jagged, influencing cell fate determination.

Customer Reviews (3)

Write a review
Reviews
01/24/2021

    Continuous access to up-to-date training materials ensured that our team remained well-versed in the product's capabilities.

    05/09/2017

      The product's evolution in response to user feedback showcased a dedication to meeting the evolving needs of researchers.

      11/04/2016

        The product's compatibility with open science practices positively influenced our decision to adopt it for our experiments.

        Ask a Question for All NOTCH1 Products

        Required fields are marked with *

        My Review for All NOTCH1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends