Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human NOTCH2

Cat.No. : NOTCH2-29660TH
Product Overview : Recombinant fragment of Human Notch 2 with N-terminal proprietary tag.Mol Wt 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. Two transcript variants encoding different isoforms have been found for this gene.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in the brain, heart, kidney, lung, skeletal muscle and liver. Ubiquitously expressed in the embryo.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRD PCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTS HPCFVSRPCLNGGTCHMLSRDTYECTCQVG
Sequence Similarities : Belongs to the NOTCH family.Contains 6 ANK repeats.Contains 35 EGF-like domains.Contains 3 LNR (Lin/Notch) repeats.
Gene Name : NOTCH2 notch 2 [ Homo sapiens ]
Official Symbol : NOTCH2
Synonyms : NOTCH2; notch 2; Notch (Drosophila) homolog 2 , Notch homolog 2 (Drosophila); neurogenic locus notch homolog protein 2;
Gene ID : 4853
mRNA Refseq : NM_001200001
Protein Refseq : NP_001186930
MIM : 600275
Uniprot ID : Q04721
Chromosome Location : 1p13-p11
Pathway : A third proteolytic cleavage releases NICD, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Dorso-ventral axis formation, organism-specific biosystem; Dorso-ventral axis formation, conserved biosystem; Gene Expression, organism-specific biosystem;
Function : calcium ion binding; ligand-regulated transcription factor activity; protein binding; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends