Recombinant Human NUF2, His-tagged

• Cat.No.: NUF2-30416TH
• Product Overview: Recombinant fragment, corresponding to amino acids 316-464 of Human Nuf2 with N terminal His tag; Predicted MWt 18 kDa.

Specification

• Description: This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the spindle pole body, and plays a regulatory role in chromosome segregation. The encoded protein is found to be associated with centromeres of mitotic HeLa cells, which suggests that this protein is a functional homolog of yeast Nuf2. Alternatively spliced transcript variants that encode the same protein have been described.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 99 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATA QFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTT INQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLKTALE KYHDGIEKAAEDSYAKIDEKTAELKRKMFKMST
• Sequence Similarities: Belongs to the NUF2 family.

Gene Information

• Gene Name: NUF2 NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: NUF2
• Synonyms: NUF2; NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae); CDCA1, cell division cycle associated 1; kinetochore protein Nuf2; cancer/testis antigen 106; CT106; NUF2R
• Gene ID: 83540
• mRNA Refseq: NM_031423
• Protein Refseq: NP_113611
• MIM: 611772
• Uniprot ID: Q9BZD4
• Chromosome Location: 1q23.3
• Pathway: Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; Mitotic Prometaphase, organism-specific biosystem
• Function: molecular_function; protein binding