Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human OTUB1, His-tagged

Cat.No. : OTUB1-28250TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-165 of Human OTUB1 with an N terminal His tag. Predicted MWt: 20 kDa;
  • Specification
  • Gene Information
  • Related Products
Description : The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitinated substrates. It interacts with another ubiquitin protease and an E3 ubiquitin ligase that inhibits cytokine gene transcription in the immune system. It is proposed to function in specific ubiquitin-dependent pathways, possibly by providing an editing function for polyubiquitin chain growth. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Source : E. coli
Tissue specificity : Isoform 1 is ubiquitous. Isoform 2 is expressed only in lymphoid tissues such as tonsils, lymph nodes and spleen, as well as peripheral blood mononuclear cells.
Form : Lyophilised:Reconstitute with 125 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQE IAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKK YSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKA VSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVA DLLASFNDQ
Sequence Similarities : Belongs to the peptidase C65 family.Contains 1 OTU domain.
Gene Name : OTUB1 OTU domain, ubiquitin aldehyde binding 1 [ Homo sapiens ]
Official Symbol : OTUB1
Synonyms : OTUB1; OTU domain, ubiquitin aldehyde binding 1; ubiquitin thioesterase OTUB1; FLJ20113; FLJ40710;
Gene ID : 55611
mRNA Refseq : NM_017670
Protein Refseq : NP_060140
MIM : 608337
Uniprot ID : Q96FW1
Chromosome Location : 11q13.1
Function : NEDD8-specific protease activity; cysteine-type peptidase activity; omega peptidase activity; peptidase activity; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All OTUB1 Products

Required fields are marked with *

My Review for All OTUB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends