Recombinant Human P4HA1
Cat.No. : | P4HA1-30543TH |
Product Overview : | Recombinant full length Human P4HA1 with a N terminal proprietary tag; Predicted MWt 84.81 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein length : | 534 amino acids |
Molecular Weight : | 84.810kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MIWYILIIGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVT SLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGH PVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQY FPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKS FLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEIS TIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQR ANGNLKYFEYIMAKEKDVNKSASDDQSDQKTTPKKKGVAV DYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPK FILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRL RRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMR IQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDA FKELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKG TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHER GQEFRRPCTLSELE |
Sequence Similarities : | Belongs to the P4HA family.Contains 1 Fe2OG dioxygenase domain.Contains 1 TPR repeat. |
Gene Name : | P4HA1 prolyl 4-hydroxylase, alpha polypeptide I [ Homo sapiens ] |
Official Symbol : | P4HA1 |
Synonyms : | P4HA1; prolyl 4-hydroxylase, alpha polypeptide I; P4HA, procollagen proline, 2 oxoglutarate 4 dioxygenase (proline 4 hydroxylase), alpha polypeptide I; prolyl 4-hydroxylase subunit alpha-1; C P4Halpha(I); collagen prolyl 4 hydroxylase alpha(I); |
Gene ID : | 5033 |
mRNA Refseq : | NM_000917 |
Protein Refseq : | NP_000908 |
MIM : | 176710 |
Uniprot ID : | P13674 |
Chromosome Location : | 10q21.3-q23.1 |
Pathway : | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | L-ascorbic acid binding; binding; iron ion binding; metal ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into bo; |
Products Types
◆ Recombinant Protein | ||
P4HA1-2637H | Recombinant Human P4HA1 Protein (18-534 aa), His-tagged | +Inquiry |
P4HA1-3902R | Recombinant Rat P4HA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
P4ha1-4640M | Recombinant Mouse P4ha1 Protein, Myc/DDK-tagged | +Inquiry |
P4HA1-3055TH | Recombinant Human P4HA1, MYC/DDK-tagged | +Inquiry |
P4ha1-1177R | Recombinant Rat P4ha1 protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
P4HA1-3482HCL | Recombinant Human P4HA1 293 Cell Lysate | +Inquiry |
P4HA1-3483HCL | Recombinant Human P4HA1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All P4HA1 Products
Required fields are marked with *
My Review for All P4HA1 Products
Required fields are marked with *
0
Inquiry Basket