Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PAH

Cat.No. : PAH-28935TH
Product Overview : Recombinant Full Length Human PAH expressed in Saccharomyces cerevisiae; amino acids 1-452; 452 amino acids, 51.9kDa.
  • Specification
  • Gene Information
  • Related Products
Description : PAH encodes the enzyme phenylalanine hydroxylase that is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFS LKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFF THLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQ FADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKT HACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPE PDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEK LATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVR NFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSE IGILCSALQKIK
Sequence Similarities : Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.Contains 1 ACT domain.
Gene Name : PAH phenylalanine hydroxylase [ Homo sapiens ]
Official Symbol : PAH
Synonyms : PAH; phenylalanine hydroxylase; phenylalanine-4-hydroxylase; PH; phenylalanine 4 monooxygenase;
Gene ID : 5053
mRNA Refseq : NM_000277
Protein Refseq : NP_000268
MIM : 612349
Uniprot ID : P00439
Chromosome Location : 12q22-q24.2
Pathway : Biogenic Amine Synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Phenylalanine and tyrosine catabolism, organism-specific biosystem;
Function : amino acid binding; iron ion binding; metal ion binding; phenylalanine 4-monooxygenase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Can PAH be treated with medications? 05/09/2022

Yes, several medications are available to manage the symptoms and slow the progression of PAH.

How can a better understanding of PAH proteins benefit patients with PAH? 01/17/2022

Understanding the role of proteins in PAH can lead to the development of more targeted and effective treatments, improving the quality of life for patients with PAH.

Are there specific biomarkers related to PAH that involve protein expression? 11/27/2021

Yes, certain biomarkers, such as brain natriuretic peptide (BNP) and endothelin-1, can be indicative of PAH.

Are there any protein-targeted therapies for PAH? 10/25/2020

Research is ongoing in the development of protein-targeted therapies for PAH, but no specific protein-targeted drugs are widely used as of my last update in January 2022.

How can proteins be used in the diagnosis and prognosis of PAH? 05/01/2019

Protein biomarkers can help in early diagnosis, and monitoring their levels can aid in assessing disease progression and response to treatment.

Customer Reviews (3)

Write a review
Reviews
06/20/2022

    I highly recommend the use of the PAH protein in various experimental applications.

    03/23/2022

      Considering its outstanding performance across multiple assays, I confidently endorse the inclusion of the PAH protein in diverse research studies.

      12/27/2021

        the PAH protein has been successfully utilized in protein electron microscopy structure analysis, providing valuable insights into molecular structures and interactions.

        Ask a Question for All PAH Products

        Required fields are marked with *

        My Review for All PAH Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends