Recombinant Human PAH
Cat.No. : | PAH-28935TH |
Product Overview : | Recombinant Full Length Human PAH expressed in Saccharomyces cerevisiae; amino acids 1-452; 452 amino acids, 51.9kDa. |
- Specification
- Gene Information
- Related Products
Description : | PAH encodes the enzyme phenylalanine hydroxylase that is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFS LKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFF THLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQ FADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKT HACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPE PDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEK LATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVR NFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSE IGILCSALQKIK |
Sequence Similarities : | Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.Contains 1 ACT domain. |
Gene Name : | PAH phenylalanine hydroxylase [ Homo sapiens ] |
Official Symbol : | PAH |
Synonyms : | PAH; phenylalanine hydroxylase; phenylalanine-4-hydroxylase; PH; phenylalanine 4 monooxygenase; |
Gene ID : | 5053 |
mRNA Refseq : | NM_000277 |
Protein Refseq : | NP_000268 |
MIM : | 612349 |
Uniprot ID : | P00439 |
Chromosome Location : | 12q22-q24.2 |
Pathway : | Biogenic Amine Synthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Phenylalanine and tyrosine catabolism, organism-specific biosystem; |
Function : | amino acid binding; iron ion binding; metal ion binding; phenylalanine 4-monooxygenase activity; |
Products Types
◆ Recombinant Protein | ||
PAH-261H | Recombinant Human PAH Protein, Flag-tagged | +Inquiry |
Pah-4659M | Recombinant Mouse Pah Protein, Myc/DDK-tagged | +Inquiry |
PAH-259H | Recombinant Human PAH Protein, MYC/DDK-tagged | +Inquiry |
PAH-1601H | Recombinant Human PAH Protein, His (Fc)-Avi-tagged | +Inquiry |
PAH-12312M | Recombinant Mouse Pah Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
PAH-461HCL | Recombinant Human PAH cell lysate | +Inquiry |
◆ Assay kits | ||
Kit-0647 | p-Aminohippuric Acid Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionYes, several medications are available to manage the symptoms and slow the progression of PAH.
Understanding the role of proteins in PAH can lead to the development of more targeted and effective treatments, improving the quality of life for patients with PAH.
Yes, certain biomarkers, such as brain natriuretic peptide (BNP) and endothelin-1, can be indicative of PAH.
Research is ongoing in the development of protein-targeted therapies for PAH, but no specific protein-targeted drugs are widely used as of my last update in January 2022.
Protein biomarkers can help in early diagnosis, and monitoring their levels can aid in assessing disease progression and response to treatment.
Customer Reviews (3)
Write a reviewI highly recommend the use of the PAH protein in various experimental applications.
Considering its outstanding performance across multiple assays, I confidently endorse the inclusion of the PAH protein in diverse research studies.
the PAH protein has been successfully utilized in protein electron microscopy structure analysis, providing valuable insights into molecular structures and interactions.
Ask a Question for All PAH Products
Required fields are marked with *
My Review for All PAH Products
Required fields are marked with *
Inquiry Basket