Recombinant Human PAM
Cat.No. : | PAM-30780TH |
Product Overview : | Recombinant fragment of Human PAM with N terminal proprietary tag; Predicted MW 37.51kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known. |
Protein length : | 108 amino acids |
Molecular Weight : | 37.510kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTR LPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMH VFAYRVHTHHLGKVVSGYRVRNGQWTLI |
Sequence Similarities : | In the C-terminal section; belongs to the peptidyl-alpha-hydroxyglycine alpha-amidating lyase family.In the N-terminal section; belongs to the copper type II ascorbate-dependent monooxygenase family.Contains 5 NHL repeats. |
Gene Name : | PAM peptidylglycine alpha-amidating monooxygenase [ Homo sapiens ] |
Official Symbol : | PAM |
Synonyms : | PAM; peptidylglycine alpha-amidating monooxygenase; peptidyl-glycine alpha-amidating monooxygenase; PAL; peptidyl alpha hydroxyglycine alpha amidating lyase; peptidylglycine alpha hydroxylating monooxygenase; PHM; |
Gene ID : | 5066 |
mRNA Refseq : | NM_000919 |
Protein Refseq : | NP_000910 |
MIM : | 170270 |
Uniprot ID : | P19021 |
Chromosome Location : | 5q |
Function : | L-ascorbic acid binding; copper ion binding; lyase activity; metal ion binding; peptidylamidoglycolate lyase activity; |
Products Types
◆ Recombinant Protein | ||
Pam-4666M | Recombinant Mouse Pam Protein, Myc/DDK-tagged | +Inquiry |
Pam-1169R | Recombinant Rat Pam Protein, His-tagged | +Inquiry |
PAM-3926R | Recombinant Rat PAM Protein, His (Fc)-Avi-tagged | +Inquiry |
Pam-1170R | Recombinant Rat Pam Protein, His-tagged | +Inquiry |
PAM-2542H | Recombinant Human PAM Protein, His-tagged | +Inquiry |
◆ Lysates | ||
PAM-3448HCL | Recombinant Human PAM 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket