Recombinant Human PAX7
Cat.No. : | PAX7-29057TH |
Product Overview : | Recombinant fragment of Human PAX7 with N terminal proprietary tag, 38.21kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 111 amino acids |
Molecular Weight : | 38.210kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT GYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCL FMESYKVVSGWGMSISQMEKLKSSQMEQFT |
Sequence Similarities : | Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.Contains 1 paired domain. |
Gene Name : | PAX7 paired box 7 [ Homo sapiens ] |
Official Symbol : | PAX7 |
Synonyms : | PAX7; paired box 7; paired box gene 7; paired box protein Pax-7; Hup1; |
Gene ID : | 5081 |
mRNA Refseq : | NM_001135254 |
Protein Refseq : | NP_001128726 |
MIM : | 167410 |
Uniprot ID : | P23759 |
Chromosome Location : | 1p36.13 |
Pathway : | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function : | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
PAX7-4801H | Recombinant Human PAX7 Protein (Arg355-Gln467), N-His tagged | +Inquiry |
PAX7-6622C | Recombinant Chicken PAX7 | +Inquiry |
PAX7-132H | Recombinant Human PAX7 protein, T7/His-tagged | +Inquiry |
PAX7-2924H | Recombinant Human PAX7 protein, His-tagged | +Inquiry |
◆ Lysates | ||
PAX7-3413HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
PAX7-3414HCL | Recombinant Human PAX7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket