Recombinant Human PDCD1

• Cat.No.: PDCD1-29487TH
• Product Overview: Recombinant fragment of Human PD1 with proprietary tag at the N terminal; Predicted MW 37.73 kDa, inclusive of tag.

Specification

• Description: This gene encodes a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, expression of this gene is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for this gene bred on a BALB/cbackground developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that this gene product may also be important in T cell function and contribute to the prevention of autoimmune diseases.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFFPA LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA AFPEDRSQPGQDCRFRVTQLPNGRDFHMSV
• Sequence Similarities: Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Gene Information

• Gene Name: PDCD1 programmed cell death 1 [ Homo sapiens ]
• Official Symbol: PDCD1
• Synonyms: PDCD1; programmed cell death 1; programmed cell death protein 1; CD279; PD1
• Gene ID: 5133
• mRNA Refseq: NM_005018
• Protein Refseq: NP_005009
• MIM: 600244
• Uniprot ID: Q15116
• Chromosome Location: 2q37.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: protein binding; protein tyrosine phosphatase activity; signal transducer activity