Recombinant Human PMF1, His-tagged
Cat.No. : | PMF1-27991TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 26-205 of Human NNF1R with N terminal His tag; 180 amino acids, 29kDa. |
- Specification
- Gene Information
- Related Products
Description : | NNF1R, also called PMF1, is part of the MIS12 complex, which may be fundamental for kinetochore formation and proper chromosome segregation during mitosis. It is required for chromosome congressionand for correct operation of the spindle checkpoint. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 52 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCF YQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEA VLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYF LQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQ VQAQQQAWQALHREQRELVAVLREPE |
Gene Name : | PMF1 polyamine-modulated factor 1 [ Homo sapiens ] |
Official Symbol : | PMF1 |
Synonyms : | PMF1; polyamine-modulated factor 1; |
Gene ID : | 11243 |
mRNA Refseq : | NM_001199653 |
Protein Refseq : | NP_001186582 |
MIM : | 609176 |
Uniprot ID : | Q6P1K2 |
Chromosome Location : | 1q22 |
Pathway : | Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; Mitotic Prometaphase, organism-specific biosystem; |
Function : | leucine zipper domain binding; protein binding; transcription coactivator activity; |
Products Types
◆ Recombinant Protein | ||
PMF1-0802H | Recombinant Human PMF1 Protein (M1-E205), Tag Free | +Inquiry |
PMF1-0803H | Recombinant Human PMF1 Protein (M1-E205), His/Strep tagged | +Inquiry |
PMF1-6872M | Recombinant Mouse PMF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PMF1-13011M | Recombinant Mouse PMF1 Protein | +Inquiry |
PMF1-1805H | Recombinant Human PMF1, GST-tagged | +Inquiry |
◆ Lysates | ||
PMF1-3089HCL | Recombinant Human PMF1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket