Recombinant Human PNLIPRP2
Cat.No. : | PNLIPRP2-30778TH |
Product Overview : | Recombinant fragment corresponding to amino acids 333-435 of Human Pancreatic Lipase Related Protein 2 with an N-terminal proprietary tag; predicted MWt 36.96 kDa. |
- Specification
- Gene Information
- Related Products
Protein length : | 103 amino acids |
Molecular Weight : | 36.960kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Pancreas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVN GYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNV GKIQKVKFLWNKRGINLSEPKLG |
Sequence Similarities : | Belongs to the AB hydrolase superfamily. Lipase family.Contains 1 PLAT domain. |
Gene Name : | PNLIPRP2 pancreatic lipase-related protein 2 [ Homo sapiens ] |
Official Symbol : | PNLIPRP2 |
Synonyms : | PNLIPRP2; pancreatic lipase-related protein 2; PLRP2; |
Gene ID : | 5408 |
mRNA Refseq : | NM_005396 |
Protein Refseq : | NP_005387 |
MIM : | 604423 |
Uniprot ID : | P54317 |
Chromosome Location : | 10q26.12 |
Pathway : | Acylglycerol degradation, organism-specific biosystem; Acylglycerol degradation, conserved biosystem; Digestion of dietary lipid, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; |
Function : | acylglycerol lipase activity; calcium ion binding; galactolipase activity; hydrolase activity; phospholipase activity; |
Products Types
◆ Recombinant Protein | ||
PNLIPRP2-2413H | Recombinant Human PNLIPRP2 Protein, MYC/DDK-tagged | +Inquiry |
PNLIPRP2-4207R | Recombinant Rat PNLIPRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PNLIPRP2-4945H | Recombinant Human PNLIPRP2 Protein (Lys18-Cys469), C-His tagged | +Inquiry |
PNLIPRP2-4547R | Recombinant Rat PNLIPRP2 Protein | +Inquiry |
PNLIPRP2-28234TH | Recombinant Human PNLIPRP2 | +Inquiry |
◆ Lysates | ||
PNLIPRP2-1281HCL | Recombinant Human PNLIPRP2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket