Recombinant Human PPP2R1A, His-tagged
Cat.No. : | PPP2R1A-27571TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 280-583 of Human PPP2R1A with N terminal His tag, 304 amino acids, 35kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRE NVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILG KDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVI GIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQ LGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKF GKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEV CGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGP ILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL |
Gene Name : | PPP2R1A protein phosphatase 2, regulatory subunit A, alpha [ Homo sapiens ] |
Official Symbol : | PPP2R1A |
Synonyms : | PPP2R1A; protein phosphatase 2, regulatory subunit A, alpha; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform , protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform; serine/threonine-protein phosphatase |
Gene ID : | 5518 |
mRNA Refseq : | NM_014225 |
Protein Refseq : | NP_055040 |
MIM : | 605983 |
Uniprot ID : | P30153 |
Chromosome Location : | 19q13 |
Pathway : | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; |
Function : | antigen binding; protein binding; protein heterodimerization activity; protein phosphatase type 2A regulator activity; protein serine/threonine phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
PPP2R1A-1750H | Recombinant Human PPP2R1A Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2R1A-3389R | Recombinant Rhesus Macaque PPP2R1A Protein, His (Fc)-Avi-tagged | +Inquiry |
Ppp2r1a-5078M | Recombinant Mouse Ppp2r1a Protein, Myc/DDK-tagged | +Inquiry |
PPP2R1A-7031M | Recombinant Mouse PPP2R1A Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2R1A-5964H | Recombinant Human PPP2R1A Protein (Met180-Ala589), C-His tagged | +Inquiry |
◆ Lysates | ||
PPP2R1A-2926HCL | Recombinant Human PPP2R1A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket