Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PTK7

Cat.No. : PTK7-27862TH
Product Overview : Recombinant fragment corresponding to amino acids 36-145 of Human CCK4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : Receptor protein tyrosine kinases transduce extracellular signals across the cell membrane. A subgroup of these kinases lack detectable catalytic tyrosine kinase activity but retain roles in signal transduction. The protein encoded by this gene is a member of this subgroup of tyrosine kinases and may function as a cell adhesion molecule. This gene is thought to be expressed in colon carcinomas but not in normal colon, and therefore may be a marker for or may be involved in tumor progression. Four transcript variants encoding four different isoforms have been found for this gene.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in lung, liver, pancreas, kidney, placenta and melanocytes. Weakly expressed in thyroid gland, ovary, brain, heart and skeletal muscle. Also expressed in erythroleukemia cells. But not expressed in colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGAPVQDT ERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSA NASFNIKWIEAGPVVLKHPASEAEIQPQTQ
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.Contains 7 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 protein kinase domain.
Gene Name : PTK7 PTK7 protein tyrosine kinase 7 [ Homo sapiens ]
Official Symbol : PTK7
Synonyms : PTK7; PTK7 protein tyrosine kinase 7; inactive tyrosine-protein kinase 7; CCK4;
Gene ID : 5754
mRNA Refseq : NM_002821
Protein Refseq : NP_002812
MIM : 601890
Uniprot ID : Q13308
Chromosome Location : 6p21.1-p12.2
Function : ATP binding; receptor activity; transferase activity, transferring phosphorus-containing groups; transmembrane receptor protein tyrosine kinase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
Does PTK7 have specific extracellular domains? 12/30/2021

Yes, PTK7 possesses extracellular domains, including a Wnt co-receptor domain, suggesting involvement in Wnt signaling pathways.

In which cellular processes does PTK7 participate? 11/07/2021

PTK7 is involved in diverse processes, including cell proliferation, migration, tissue morphogenesis, and planar cell polarity.

Are there potential therapeutic applications for PTK7? 10/29/2021

PTK7 is being explored as a potential therapeutic target, particularly in cancer treatment and tissue regeneration.

What role does PTK7 play in planar cell polarity? 04/10/2020

PTK7 plays a pivotal role in planar cell polarity, contributing to the alignment of cells and tissues during development.

What is the full name of PTK7? 06/04/2019

PTK7 stands for Protein Tyrosine Kinase 7.

What kind of protein is PTK7? 07/24/2018

PTK7 is a transmembrane receptor protein with tyrosine kinase activity.

Is PTK7 implicated in any diseases? 09/19/2016

Altered expression of PTK7 has been associated with various cancers, including colorectal cancer.

Customer Reviews (3)

Write a review
Reviews
09/09/2019

    We observed that results obtained with the product remained stable and reliable over long-term experiments.

    06/19/2019

      We appreciated that the product adhered to relevant regulatory standards, ensuring the ethical conduct of our experiments.

      02/12/2019

        The product's compliance with safety and ethical guidelines made it a responsible choice for our research endeavors.

        Ask a Question for All PTK7 Products

        Required fields are marked with *

        My Review for All PTK7 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends