Recombinant Human PTPN23, His-tagged
Cat.No. : | PTPN23-29212TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1109-1447 of Human HDPTP with N terminal His tag; 339 amino acids, 39kDa. |
- Specification
- Gene Information
- Related Products
Description : | HDPTP (also known as PTPN23) is a protein tyrosine phosphatase that was isolated from a gastric cancer cell line. The predicted protein contains at least 1,636 amino acids and has several features distinct from those in previously identified PTPs, the most striking of which is the sequence VHCSSG instead of the invariant VHCSAG sequence at the PTP active center. PTPN23 contains a zinc-hand domain [also known as a His domain (HD)]; several SH3-binding motifs; a tyrosine phosphatase domain; a C-terminal PEST motif; and an N-terminal domain similar to yeast BRO1, mouse rhophilin, and human AIP1. It appears to be the homolog of rat PTPTD14 which has been found to inhibit activated H-ras-mediated cell transformation. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 118 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CLRRGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTKVDA AEGRRPQALRLIERDPYEHPERLRQLQQELEAFRGQLG DVGALDTVWRELQDAQEHDARGRSIAIARCYSLKNRHQDV MPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVATQA PLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARY FPTERGQPMVHGALSLALSSVRSTETHVERVLSLQFRDQS LKRSLVHLHFPTWPELGLPDSPSNLLRFIQEVHAHYLH QRPLHTPIIVHCSSGVGRTGAFALLYAAVQEVEAGNGI PELPQLVRRMRQQRKHMLQEKLHLRFCYE |
Gene Name : | PTPN23 protein tyrosine phosphatase, non-receptor type 23 [ Homo sapiens ] |
Official Symbol : | PTPN23 |
Synonyms : | PTPN23; protein tyrosine phosphatase, non-receptor type 23; tyrosine-protein phosphatase non-receptor type 23; DKFZP564F0923; HD PTP; KIAA1471; |
Gene ID : | 25930 |
mRNA Refseq : | NM_015466 |
Protein Refseq : | NP_056281 |
MIM : | 606584 |
Uniprot ID : | Q9H3S7 |
Chromosome Location : | 3p21.3 |
Function : | hydrolase activity; protein binding; protein tyrosine phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
PTPN23-7280M | Recombinant Mouse PTPN23 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPN23-01H | Recombinant Human PTPN23 Protein, GST-tagged | +Inquiry |
PTPN23-13684M | Recombinant Mouse PTPN23 Protein | +Inquiry |
◆ Lysates | ||
PTPN23-1438HCL | Recombinant Human PTPN23 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket