Recombinant Human RANGAP1, His-tagged
Cat.No. : | RANGAP1-30474TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-357 of Human RanGAP1 with N terminal His tag. MWt 41kDa; |
- Specification
- Gene Information
- Related Products
Description : | RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGAP1 gene encodes a 587-amino acid polypeptide. The sequence is unrelated to that of GTPase activators for other RAS-related proteins, but is 88% identical to Fug1, the murine homolog of yeast Rna1p. RanGAP1 and RCC1 control RAN-dependent transport between the nucleus and cytoplasm. RanGAP1 is a key regulator of the RAN GTP/GDP cycle. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Highly expressed in brain, thymus and testis. |
Form : | Lyophilised:Reconstitution with 98 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKD VIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSE LKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVE LDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGI GGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLEN DGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAF AVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFG DCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAA LAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGF NMAKVLASL |
Sequence Similarities : | Belongs to the RNA1 family.Contains 6 LRR (leucine-rich) repeats. |
Gene Name : | RANGAP1 Ran GTPase activating protein 1 [ Homo sapiens ] |
Official Symbol : | RANGAP1 |
Synonyms : | RANGAP1; Ran GTPase activating protein 1; SD, segregation distorter homolog (Drosophila); ran GTPase-activating protein 1; Fug1; KIAA1835; |
Gene ID : | 5905 |
mRNA Refseq : | NM_002883 |
Protein Refseq : | NP_002874 |
MIM : | 602362 |
Uniprot ID : | P46060 |
Chromosome Location : | 22q13 |
Pathway : | Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem; |
Function : | GTPase activator activity; Ran GTPase activator activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
RANGAP1-12H | Recombinant Human RANGAP1 Protein, His-tagged | +Inquiry |
Rangap1-5370M | Recombinant Mouse Rangap1 Protein, Myc/DDK-tagged | +Inquiry |
RANGAP1-7416M | Recombinant Mouse RANGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RANGAP1-682H | Recombinant Human Ran GTPase Activating Protein 1, GST-tagged | +Inquiry |
RANGAP1-38H | Recombinant Human RANGAP1 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
RANGAP1-2532HCL | Recombinant Human RANGAP1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket