Recombinant Human RBBP5, His-tagged
Cat.No. : | RBBP5-28182TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 359-538 of Human RbBP5 with an N terminal His tag. Predicted mwt: 20 kDa; |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. The encoded protein binds directly to retinoblastoma protein, which regulates cell proliferation. It interacts preferentially with the underphosphorylated retinoblastoma protein via the E1A-binding pocket B. Three alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitously expressed. |
Form : | Lyophilised:Reconstitute with 148 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKA LLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEK KRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVK GDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEG SAKGKVQAELSQPLTAGGAISELL |
Sequence Similarities : | Contains 6 WD repeats. |
Gene Name : | RBBP5 retinoblastoma binding protein 5 [ Homo sapiens ] |
Official Symbol : | RBBP5 |
Synonyms : | RBBP5; retinoblastoma binding protein 5; retinoblastoma-binding protein 5; RBQ3; SWD1; Set1c WD40 repeat protein; homolog (S. cerevisiae); |
Gene ID : | 5929 |
mRNA Refseq : | NM_001193272 |
Protein Refseq : | NP_001180201 |
MIM : | 600697 |
Uniprot ID : | Q15291 |
Chromosome Location : | 1q32 |
Function : | contributes_to histone methyltransferase activity (H3-K4 specific); methylated histone residue binding; protein binding; transcription regulatory region DNA binding; |
Products Types
◆ Recombinant Protein | ||
RBBP5-7458M | Recombinant Mouse RBBP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBBP5-082H | Active Recombinant Human RBBP5 Protein | +Inquiry |
RBBP5-025H | Active Recombinant Human RBBP5 Protein, SUMO-tagged | +Inquiry |
RBBP5-13977M | Recombinant Mouse RBBP5 Protein | +Inquiry |
RBBP5-2199H | Recombinant Human RBBP5, GST-tagged | +Inquiry |
◆ Lysates | ||
RBBP5-1479HCL | Recombinant Human RBBP5 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket