Recombinant Human RPL5, His-tagged
Cat.No. : | RPL5-31335TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 99-297 of Human RPL5 with an N terminal His tag. Predicted mwt: 24 kDa; |
- Specification
- Gene Information
- Related Products
Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18P family of ribosomal proteins. It is located in the cytoplasm. The protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The protein interacts specifically with the beta subunit of casein kinase II. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 46 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQ PGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHS TKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEE DEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYE KKPKKEVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQE RAAES |
Sequence Similarities : | Belongs to the ribosomal protein L18P family. |
Gene Name : | RPL5 ribosomal protein L5 [ Homo sapiens ] |
Official Symbol : | RPL5 |
Synonyms : | RPL5; ribosomal protein L5; 60S ribosomal protein L5; L5; |
Gene ID : | 6125 |
mRNA Refseq : | NM_000969 |
Protein Refseq : | NP_000960 |
MIM : | 603634 |
Uniprot ID : | P46777 |
Chromosome Location : | 1p22.1 |
Pathway : | Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem; |
Function : | 5S rRNA binding; RNA binding; protein binding; structural constituent of ribosome; structural constituent of ribosome; |
Products Types
◆ Recombinant Protein | ||
RPL5-7749M | Recombinant Mouse RPL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL5-4794R | Recombinant Rat RPL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL5-624C | Recombinant Cynomolgus Monkey RPL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL5-5135R | Recombinant Rat RPL5 Protein | +Inquiry |
RPL5-881C | Recombinant Cynomolgus RPL5 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
RPL5-2192HCL | Recombinant Human RPL5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket