Recombinant Human RPL7A, His-tagged
Cat.No. : | RPL7A-31337TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 29-266 of Human RPL7A with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L7AE family of ribosomal proteins. It can interact with a subclass of nuclear hormone receptors, including thyroid hormone receptor, and inhibit their ability to transactivate by preventing their binding to their DNA response elements. This gene is included in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. It is co-transcribed with the U24, U36a, U36b, and U36c small nucleolar RNA genes, which are located in its second, fifth, fourth, and sixth introns, respectively. This gene rearranges with the trk proto-oncogene to form the chimeric oncogene trk-2h, which encodes an oncoprotein consisting of the N terminus of ribosomal protein L7a fused to the receptor tyrosine kinase domain of trk. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 121 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRA ILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPET KQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVT TLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYC IIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAI RTNYNDRYDEIRRHWGGNVLGPKSVARIAKLEKAKAKE LATKLG |
Sequence Similarities : | Belongs to the ribosomal protein L7Ae family. |
Gene Name : | RPL7A ribosomal protein L7a [ Homo sapiens ] |
Official Symbol : | RPL7A |
Synonyms : | RPL7A; ribosomal protein L7a; 60S ribosomal protein L7a;; L7A; PLA X polypeptide; SURF3; surfeit 3; surfeit locus protein 3; thyroid hormone receptor uncoupling protein; TRUP; |
Gene ID : | 6130 |
mRNA Refseq : | NM_000972 |
Protein Refseq : | NP_000963 |
MIM : | 185640 |
Uniprot ID : | P62424 |
Chromosome Location : | 9q34 |
Pathway : | Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem; |
Function : | RNA binding; protein binding; structural constituent of ribosome; |
Products Types
◆ Recombinant Protein | ||
RPL7A-626C | Recombinant Cynomolgus Monkey RPL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL7A-3811R | Recombinant Rhesus Macaque RPL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL7A-7752M | Recombinant Mouse RPL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL7A-10402Z | Recombinant Zebrafish RPL7A | +Inquiry |
RPL7A-3994R | Recombinant Rhesus monkey RPL7A Protein, His-tagged | +Inquiry |
◆ Lysates | ||
RPL7A-2189HCL | Recombinant Human RPL7A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RPL7A Products
Required fields are marked with *
My Review for All RPL7A Products
Required fields are marked with *
0
Inquiry Basket