Recombinant Human RRAD
Cat.No. : | RRAD-30772TH |
Product Overview : | Recombinant fragment of Human RRAD with an N terminal proprietary tag; Predicted MW 37.73kDa. |
- Specification
- Gene Information
- Related Products
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRS IVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYS VTDKGSFEKASELRVQLRRARQTDDVPIIL |
Sequence Similarities : | Belongs to the small GTPase superfamily. RGK family. |
Gene Name : | RRAD Ras-related associated with diabetes [ Homo sapiens ] |
Official Symbol : | RRAD |
Synonyms : | RRAD; Ras-related associated with diabetes; GTP-binding protein RAD; RAD; REM3; |
Gene ID : | 6236 |
mRNA Refseq : | NM_001128850 |
Protein Refseq : | NP_001122322 |
MIM : | 179503 |
Uniprot ID : | P55042 |
Chromosome Location : | 16q22 |
Pathway : | Insulin Signaling, organism-specific biosystem; |
Function : | GTP binding; GTPase activity; calmodulin binding; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
RRAD-1918H | Recombinant Human RRAD Protein, His (Fc)-Avi-tagged | +Inquiry |
Rrad-5618M | Recombinant Mouse Rrad Protein, Myc/DDK-tagged | +Inquiry |
RRAD-4985C | Recombinant Chicken RRAD | +Inquiry |
RRAD-10186Z | Recombinant Zebrafish RRAD | +Inquiry |
RRAD-2818H | Recombinant Human RRAD protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RRAD Products
Required fields are marked with *
My Review for All RRAD Products
Required fields are marked with *
0
Inquiry Basket