Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human RRAD

Cat.No. : RRAD-30772TH
Product Overview : Recombinant fragment of Human RRAD with an N terminal proprietary tag; Predicted MW 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRS IVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYS VTDKGSFEKASELRVQLRRARQTDDVPIIL
Sequence Similarities : Belongs to the small GTPase superfamily. RGK family.
Gene Name : RRAD Ras-related associated with diabetes [ Homo sapiens ]
Official Symbol : RRAD
Synonyms : RRAD; Ras-related associated with diabetes; GTP-binding protein RAD; RAD; REM3;
Gene ID : 6236
mRNA Refseq : NM_001128850
Protein Refseq : NP_001122322
MIM : 179503
Uniprot ID : P55042
Chromosome Location : 16q22
Pathway : Insulin Signaling, organism-specific biosystem;
Function : GTP binding; GTPase activity; calmodulin binding; nucleotide binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RRAD Products

Required fields are marked with *

My Review for All RRAD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends