Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SFTPB

Cat.No. : SFTPB-30333TH
Product Overview : Recombinant full length Human Prosurfactant Protein B with an N-terminal proprietary tag, 67.98kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.
Protein length : 381 amino acids
Molecular Weight : 67.980kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWC QSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILN KMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYF PLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPL PKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQ FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPL VAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMD DSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQA MLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTC QALGVCGTMSSPLQCIHSPDL
Sequence Similarities : Contains 1 saposin A-type domain.Contains 3 saposin B-type domains.
Gene Name : SFTPB surfactant protein B [ Homo sapiens ]
Official Symbol : SFTPB
Synonyms : SFTPB; surfactant protein B; SFTP3, surfactant, pulmonary associated protein B; pulmonary surfactant-associated protein B; SP B;
Gene ID : 6439
mRNA Refseq : NM_000542
Protein Refseq : NP_000533
MIM : 178640
Uniprot ID : P07988
Chromosome Location : 2p12-p11.2

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
In what clinical conditions might the measurement of SFTPB levels be relevant? 08/27/2022

The measurement of SFTPB levels is relevant in conditions such as respiratory distress syndrome, interstitial lung diseases, and certain genetic disorders affecting surfactant production.

How does SFTPB research contribute to the development of novel drugs for respiratory diseases? 02/17/2021

Research on SFTPB provides insights into the molecular mechanisms of lung function, facilitating the development of targeted drugs to address surfactant deficiencies.

Are there any advancements in diagnostic technologies that enhance the detection of SFTPB abnormalities? 04/08/2019

Advancements in genetic testing and imaging technologies have improved the accuracy and efficiency of detecting SFTPB abnormalities, aiding in early diagnosis.

Can mutations in the SFTPB gene contribute to respiratory diseases? 09/24/2017

Yes, mutations in the SFTPB gene can lead to dysfunctional SFTPB protein, contributing to various respiratory diseases.

How is the clinical diagnosis of SFTPB-related disorders typically conducted? 05/06/2016

Clinical diagnosis involves assessing respiratory symptoms, conducting imaging studies, and performing genetic testing to identify mutations in the SFTPB gene.

Customer Reviews (3)

Write a review
Reviews
03/04/2022

    Its outstanding performance, coupled with its ease of use, has enhanced the overall efficiency and accuracy of my research.

    05/31/2020

      The SFTPB Protein has greatly contributed to the success of my experiments, providing reliable and robust data.

      07/22/2016

        I highly recommend the SFTPB Protein to researchers seeking a reliable and high-performing protein for their ELISA assays and protein electron microscopy structure analysis.

        Ask a Question for All SFTPB Products

        Required fields are marked with *

        My Review for All SFTPB Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends