Recombinant Human SFTPB
Cat.No. : | SFTPB-30333TH |
Product Overview : | Recombinant full length Human Prosurfactant Protein B with an N-terminal proprietary tag, 67.98kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified. |
Protein length : | 381 amino acids |
Molecular Weight : | 67.980kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWC QSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILN KMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYF PLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPL PKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQ FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPL VAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMD DSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQA MLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTC QALGVCGTMSSPLQCIHSPDL |
Sequence Similarities : | Contains 1 saposin A-type domain.Contains 3 saposin B-type domains. |
Gene Name : | SFTPB surfactant protein B [ Homo sapiens ] |
Official Symbol : | SFTPB |
Synonyms : | SFTPB; surfactant protein B; SFTP3, surfactant, pulmonary associated protein B; pulmonary surfactant-associated protein B; SP B; |
Gene ID : | 6439 |
mRNA Refseq : | NM_000542 |
Protein Refseq : | NP_000533 |
MIM : | 178640 |
Uniprot ID : | P07988 |
Chromosome Location : | 2p12-p11.2 |
Products Types
◆ Recombinant Protein | ||
SFTPB-2810H | Recombinant Human SFTPB Protein (201-279 aa), MBP-tagged | +Inquiry |
SFTPB-1993H | Recombinant Human SFTPB Protein, His (Fc)-Avi-tagged | +Inquiry |
Sftpb-5816M | Recombinant Mouse Sftpb Protein, Myc/DDK-tagged | +Inquiry |
SFTPB-5017R | Recombinant Rat SFTPB Protein, His (Fc)-Avi-tagged | +Inquiry |
SFTPB-2286B | Recombinant Bovine SFTPB Protein (23-187 aa), His-Myc-tagged | +Inquiry |
◆ Lysates | ||
SFTPB-1897HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
SFTPB-1898HCL | Recombinant Human SFTPB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionThe measurement of SFTPB levels is relevant in conditions such as respiratory distress syndrome, interstitial lung diseases, and certain genetic disorders affecting surfactant production.
Research on SFTPB provides insights into the molecular mechanisms of lung function, facilitating the development of targeted drugs to address surfactant deficiencies.
Advancements in genetic testing and imaging technologies have improved the accuracy and efficiency of detecting SFTPB abnormalities, aiding in early diagnosis.
Yes, mutations in the SFTPB gene can lead to dysfunctional SFTPB protein, contributing to various respiratory diseases.
Clinical diagnosis involves assessing respiratory symptoms, conducting imaging studies, and performing genetic testing to identify mutations in the SFTPB gene.
Customer Reviews (3)
Write a reviewIts outstanding performance, coupled with its ease of use, has enhanced the overall efficiency and accuracy of my research.
The SFTPB Protein has greatly contributed to the success of my experiments, providing reliable and robust data.
I highly recommend the SFTPB Protein to researchers seeking a reliable and high-performing protein for their ELISA assays and protein electron microscopy structure analysis.
Ask a Question for All SFTPB Products
Required fields are marked with *
My Review for All SFTPB Products
Required fields are marked with *
Inquiry Basket