Recombinant Human SMO
Cat.No. : | SMO-31422TH |
Product Overview : | Recombinant fragment corresponding to amino acids 653-787 of Human Smoothened with an N terminal proprietary tag; Predicted MWt 40.48 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex. |
Protein length : | 135 amino acids |
Molecular Weight : | 40.480kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELH PPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAW TLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIH SRTNLMDTELMDADSDF |
Sequence Similarities : | Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain. |
Gene Name : | SMO smoothened, frizzled family receptor [ Homo sapiens ] |
Official Symbol : | SMO |
Synonyms : | SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11; |
Gene ID : | 6608 |
mRNA Refseq : | NM_005631 |
Protein Refseq : | NP_005622 |
MIM : | 601500 |
Uniprot ID : | Q99835 |
Chromosome Location : | 7q32.1 |
Pathway : | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; |
Function : | G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding; |
Products Types
◆ Recombinant Protein | ||
Smo-2084M | Recombinant Mouse Smo Protein, His-tagged | +Inquiry |
SMO-2707H | Recombinant Human SMO Protein, His-tagged | +Inquiry |
SMO-5282R | Recombinant Rat SMO Protein, His (Fc)-Avi-tagged | +Inquiry |
SMO-4097H | Recombinant Human SMO Protein, His (Fc)-Avi-tagged | +Inquiry |
SMO-8486M | Recombinant Mouse SMO Protein, His (Fc)-Avi-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket