Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SNAI1

Cat.No. : SNAI1-30016TH
Product Overview : Recombinant fragment corresponding to amino acids 121-230 of Human SNAIL with a N terminal proprietary tag; predicted MWt 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCN KEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTH
Sequence Similarities : Belongs to the snail C2H2-type zinc-finger protein family.Contains 4 C2H2-type zinc fingers.
Gene Name : SNAI1 snail homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol : SNAI1
Synonyms : SNAI1; snail homolog 1 (Drosophila); snail 1 (drosophila homolog), zinc finger protein; zinc finger protein SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1;
Gene ID : 6615
mRNA Refseq : NM_005985
Protein Refseq : NP_005976
MIM : 604238
Uniprot ID : O95863
Chromosome Location : 20q13.2
Pathway : Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met), organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function : kinase binding; metal ion binding; protein binding; sequence-specific DNA binding; zinc ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (3)

Write a review
Reviews
07/14/2022

    Timely delivery, so I got the desired experimental results in the shortest possible time.

    11/26/2021

      I have a dedicated staff member who is in contact with me and he keep me informed of the progress of my experiments.

      01/02/2021

        The purchased product information is in line with the advertising campaign and is conducive to obtaining accurate experimental results.

        Ask a Question for All SNAI1 Products

        Required fields are marked with *

        My Review for All SNAI1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends