Recombinant Human SNAP47, His-tagged

• Cat.No.: SNAP47-29598TH
• Product Overview: Recombinant fragment, corresponding to amino acids 231-378 of Human SNAP47 with N terminal His tag; 148 amino acids, 24kDa.

Specification

• Description: SNAP47 belongs to the SVAP1 family. It contains two t-SNARE coiled-coil homology domains.SNAP47 has ubiquitous tissue distribution, with particularly high levels in nervous tissue. In neurons, SNAP 47 has been shown to havewidespread distribution on intracellular membranes and is enriched in synaptic vesicle fractions. In vitro, SNAP 47 can substitute for SNAP-25 in SNARE complex formation,but not as efficiently.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 55 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FIGKPDMAYRLISAKMPEVIPILEVQFSKKMELLEDALVL RSARTSSPAEKSCSVWHAASGLMGRTLHREPPAGDQEG TALHLQTSLPALSEADTQELTQILRRMKGLALEAESEL ERQDEALDGVAAAVDRATLTIDKHNRRMKRLT

Gene Information

• Gene Name: SNAP47 synaptosomal-associated protein, 47kDa [ Homo sapiens ]
• Official Symbol: SNAP47
• Synonyms: SNAP47; synaptosomal-associated protein, 47kDa; C1orf142, chromosome 1 open reading frame 142; synaptosomal-associated protein 47; SNAP 47; SVAP1
• Gene ID: 116841
• mRNA Refseq: NM_053052
• Protein Refseq: NP_444280
• Uniprot ID: Q5SQN1
• Chromosome Location: 1q42.13
• Pathway: SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem