Recombinant Human SSR1
Cat.No. : | SSR1-31606TH |
Product Overview : | Recombinant fragment of Human TRAP alpha with N-terminal proprietary tag, 54.05 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. |
Protein length : | 254 amino acids |
Molecular Weight : | 54.050kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEED VSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGT EDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQA TFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQ TVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESR KRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRL PRKRAQKRSVGSDE |
Sequence Similarities : | Belongs to the TRAP-alpha family. |
Gene Name : | SSR1 signal sequence receptor, alpha [ Homo sapiens ] |
Official Symbol : | SSR1 |
Synonyms : | SSR1; signal sequence receptor, alpha; translocon-associated protein subunit alpha; translocon associated protein alpha; TRAPA; |
Gene ID : | 6745 |
mRNA Refseq : | NM_003144 |
Protein Refseq : | NP_003135 |
MIM : | 600868 |
Uniprot ID : | P43307 |
Chromosome Location : | 6p24.3 |
Pathway : | Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; |
Function : | signal sequence binding; |
Products Types
◆ Recombinant Protein | ||
SSR1-4305R | Recombinant Rhesus Macaque SSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ssr1-332M | Recombinant Mouse Ssr1 Protein, MYC/DDK-tagged | +Inquiry |
SSR1-8747M | Recombinant Mouse SSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSR1-691H | Recombinant Human SSR1 Protein, Fc-tagged | +Inquiry |
SSR1-1518C | Recombinant Chicken SSR1 | +Inquiry |
◆ Lysates | ||
SSR1-1459HCL | Recombinant Human SSR1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket