Recombinant Human STK40, His-tagged
Cat.No. : | STK40-29510TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 357-435 of Human STK40 with a N terminal His tag; predicted MWt 10kDa: |
- Specification
- Gene Information
- Related Products
Description : | Serine/threonine-protein kinase 40 is an enzyme that in humans is encoded by the STK40 gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 75 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDAR SWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLR K |
Gene Name : | STK40 serine/threonine kinase 40 [ Homo sapiens ] |
Official Symbol : | STK40 |
Synonyms : | STK40; serine/threonine kinase 40; serine/threonine-protein kinase 40; MGC4796; SgK495; |
Gene ID : | 83931 |
mRNA Refseq : | NM_032017 |
Protein Refseq : | NP_114406 |
MIM : | 609437 |
Uniprot ID : | Q8N2I9 |
Chromosome Location : | 1p34.3 |
Function : | ATP binding; nucleotide binding; protein serine/threonine kinase activity; |
Products Types
◆ Recombinant Protein | ||
STK40-8813M | Recombinant Mouse STK40 Protein, His (Fc)-Avi-tagged | +Inquiry |
STK40-5454R | Recombinant Rat STK40 Protein, His (Fc)-Avi-tagged | +Inquiry |
STK40-831H | Recombinant Human STK40, GST-tagged | +Inquiry |
STK40-6036C | Recombinant Chicken STK40 | +Inquiry |
STK40-16152M | Recombinant Mouse STK40 Protein | +Inquiry |
◆ Lysates | ||
STK40-408HCL | Recombinant Human STK40 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket