Recombinant Human TAPBP
Cat.No. : | TAPBP-31499TH |
Product Overview : | Recombinant fragment Human Tapasin with N-terminal proprietary tag. Predicted MW 37.07kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms. |
Protein length : | 104 amino acids |
Molecular Weight : | 37.070kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Neutrophils, mostly in fully differentiated cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PGPPPFGLEWRRQHLGKGHLLLAATPGLNGQMPAAQEGAV AFAAWDDDEPWGPWTGNGTFWLPTVQPFQEGTYLATIHLP YLQGQVTLELAVYKPPKVSLMPAT |
Sequence Similarities : | Contains 1 Ig-like C1-type (immunoglobulin-like) domain. |
Gene Name : | TAPBP TAP binding protein (tapasin) [ Homo sapiens ] |
Official Symbol : | TAPBP |
Synonyms : | TAPBP; TAP binding protein (tapasin); tapasin; TAPA; |
Gene ID : | 6892 |
mRNA Refseq : | NM_172209 |
Protein Refseq : | NP_757346 |
MIM : | 601962 |
Uniprot ID : | O15533 |
Chromosome Location : | 6p21.3 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Antigen Presentation: Folding, assembly and peptide loading of class I MHC, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Antigen processing-Cross presentation, organism-specific biosystem; |
Function : | MHC class I protein binding; TAP1 binding; TAP1 binding; TAP2 binding; TAP2 binding; |
Products Types
◆ Recombinant Protein | ||
TAPBP-4432R | Recombinant Rhesus Macaque TAPBP Protein, His (Fc)-Avi-tagged | +Inquiry |
Tapbp-6292M | Recombinant Mouse Tapbp Protein, Myc/DDK-tagged | +Inquiry |
TAPBP-122H | Recombinant Human TAPBP Protein, MYC/DDK-tagged | +Inquiry |
TAPBP-154H | Recombinant Human TAPBP Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAPBP-4616R | Recombinant Rhesus monkey TAPBP Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket