Recombinant Human TMSB4X
Cat.No. : | TMSB4X-30407TH |
Product Overview : | Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa;. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. |
Protein length : | 44 amino acids |
Molecular Weight : | 30.840kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Sequence Similarities : | Belongs to the thymosin beta family. |
Gene Name : | TMSB4X thymosin beta 4, X-linked [ Homo sapiens ] |
Official Symbol : | TMSB4X |
Synonyms : | TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X; |
Gene ID : | 7114 |
mRNA Refseq : | NM_021109 |
Protein Refseq : | NP_066932 |
MIM : | 300159 |
Uniprot ID : | P62328 |
Chromosome Location : | Xq21.3-q22 |
Pathway : | Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; |
Function : | actin binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
TMSB4X-9459M | Recombinant Mouse TMSB4X Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmsb4x-6531M | Recombinant Mouse Tmsb4x Protein, Myc/DDK-tagged | +Inquiry |
TMSB4X-5846R | Recombinant Rat TMSB4X Protein, His (Fc)-Avi-tagged | +Inquiry |
TMSB4X-4669R | Recombinant Rhesus Macaque TMSB4X Protein, His (Fc)-Avi-tagged | +Inquiry |
TMSB4X-891H | Recombinant Human TMSB4X Protein | +Inquiry |
◆ Lysates | ||
TMSB4X-904HCL | Recombinant Human TMSB4X 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TMSB4X Products
Required fields are marked with *
My Review for All TMSB4X Products
Required fields are marked with *
0
Inquiry Basket