Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human TNC

Cat.No. : TNC-31215TH
Product Overview : Recombinant fragment corresponding to amino acids 181-290 of Human Tenascin C with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLA CPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEH GTCVDGLCVCHDGFAGDDCNKPLCLNNCYN
Sequence Similarities : Belongs to the tenascin family.Contains 15 EGF-like domains.Contains 1 fibrinogen C-terminal domain.Contains 15 fibronectin type-III domains.
Gene Name : TNC tenascin C [ Homo sapiens ]
Official Symbol : TNC
Synonyms : TNC; tenascin C; hexabrachion (tenascin C, cytotactin) , HXB; tenascin; hexabrachion (tenascin); MGC167029; TN;
Gene ID : 3371
mRNA Refseq : NM_002160
Protein Refseq : NP_002151
MIM : 187380
Uniprot ID : P24821
Chromosome Location : 9q32-q34
Pathway : ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function : binding; receptor binding; syndecan binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
Is there an association between TNC protein and cardiovascular disease? 12/28/2019

Some studies have found that TNC protein plays a role in cardiovascular diseases such as atherosclerosis, myocardial infarction, etc., and may participate in pathophysiological processes.

Which role of TNC protein in the nervous system? 09/01/2019

TNC protein plays an important role in the development and repair of the nervous system, including neuronal migration, axon growth and synapse formation.

Are there an association between TNC protein and neurodegenerative diseases? 05/23/2019

Some studies have found that TNC protein is associated with neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease, and may be involved in the occurrence and development of diseases.

Is there a relationship between the measurement of TNC protein and its function? 05/18/2019

TNC protein measurement can be used for cancer diagnosis and disease prognosis, but further studies are needed to confirm a direct link with TNC protein function.

What is the relationship between TNC protein and immune regulation? 02/18/2019

TNC protein plays a role in immune regulation, can regulate inflammatory response, promote the activation and migration of immune cells, etc.

What is the relationship between TNC protein and tissue repair? 02/18/2019

This protein plays an important role in tissue repair, can regulate cell migration, cell proliferation, and the formation of new blood vessels, and promote tissue repair.

Customer Reviews (3)

Write a review
Reviews
12/03/2020

    Using TNC, the lower limit of detection of Western blot was significantly reduced.

    12/30/2019

      The repeatability of TNC is very good, which can reduce the error in the experiment and improve the reproducibility of the experiment.

      09/19/2019

        TNC were labeled very well and could be used for fluorescent labeling, etc., which was very suitable for our study.

        Ask a Question for All TNC Products

        Required fields are marked with *

        My Review for All TNC Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends