Recombinant Human TNC
Cat.No. : | TNC-31215TH |
Product Overview : | Recombinant fragment corresponding to amino acids 181-290 of Human Tenascin C with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLA CPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEH GTCVDGLCVCHDGFAGDDCNKPLCLNNCYN |
Sequence Similarities : | Belongs to the tenascin family.Contains 15 EGF-like domains.Contains 1 fibrinogen C-terminal domain.Contains 15 fibronectin type-III domains. |
Gene Name : | TNC tenascin C [ Homo sapiens ] |
Official Symbol : | TNC |
Synonyms : | TNC; tenascin C; hexabrachion (tenascin C, cytotactin) , HXB; tenascin; hexabrachion (tenascin); MGC167029; TN; |
Gene ID : | 3371 |
mRNA Refseq : | NM_002160 |
Protein Refseq : | NP_002151 |
MIM : | 187380 |
Uniprot ID : | P24821 |
Chromosome Location : | 9q32-q34 |
Pathway : | ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function : | binding; receptor binding; syndecan binding; |
Products Types
◆ Recombinant Protein | ||
TNC-4224H | Recombinant Human TNC Protein, His (Fc)-Avi-tagged | +Inquiry |
TNC-2216H | Recombinant Human TNC Protein, His (Fc)-Avi-tagged | +Inquiry |
TNC-32H | Recombinant Human TNC Partial Protein, His-tagged | +Inquiry |
TNC-311H | Recombinant Human Transthyretin (Wild Type) Protein, 13C, 15N Label | +Inquiry |
Tnc-6538M | Recombinant Mouse Tnc Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Protein | ||
TNC-50H | Native Human Tenascin C | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionSome studies have found that TNC protein plays a role in cardiovascular diseases such as atherosclerosis, myocardial infarction, etc., and may participate in pathophysiological processes.
TNC protein plays an important role in the development and repair of the nervous system, including neuronal migration, axon growth and synapse formation.
Some studies have found that TNC protein is associated with neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease, and may be involved in the occurrence and development of diseases.
TNC protein measurement can be used for cancer diagnosis and disease prognosis, but further studies are needed to confirm a direct link with TNC protein function.
TNC protein plays a role in immune regulation, can regulate inflammatory response, promote the activation and migration of immune cells, etc.
This protein plays an important role in tissue repair, can regulate cell migration, cell proliferation, and the formation of new blood vessels, and promote tissue repair.
Customer Reviews (3)
Write a reviewUsing TNC, the lower limit of detection of Western blot was significantly reduced.
The repeatability of TNC is very good, which can reduce the error in the experiment and improve the reproducibility of the experiment.
TNC were labeled very well and could be used for fluorescent labeling, etc., which was very suitable for our study.
Ask a Question for All TNC Products
Required fields are marked with *
My Review for All TNC Products
Required fields are marked with *
Inquiry Basket