Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human TYMS, His-tagged

Cat.No. : TYMS-30405TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-191 of Human Thymidylate Synthase with N terminal His tag; MWt 22kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 97 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHI LRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKR VFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRD FLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYS GQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMA
Gene ID : TYMS thymidylate synthetase [ Homo sapiens ]
Official Symbol : TYMS
Synonyms : TYMS; thymidylate synthetase; TS; thymidylate synthase; HsT422; TMS; Tsase;
Gene ID : TYMS thymidylate synthetase [ Homo sapiens ]
Official Symbol : TYMS
Synonyms : TYMS; thymidylate synthetase; TS; thymidylate synthase; HsT422; TMS; Tsase;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All TYMS Products

Required fields are marked with *

My Review for All TYMS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends