Recombinant Human UBE2D2
Cat.No. : | UBE2D2-30042TH |
Product Overview : | Tagged Recombinant Human UBE2D2. |
- Specification
- Gene Information
- Related Products
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 50mM HEPES, 100mM Sodium chloride, pH 8 |
Storage : | Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | The sequence (minus the tag) is:MALKRIHKELNDLARDPPAQCSAGPVGDDMFHW QATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT RIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLC DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM |
Sequence Similarities : | Belongs to the ubiquitin-conjugating enzyme family. |
Gene Name : | UBE2D2 ubiquitin-conjugating enzyme E2D 2 [ Homo sapiens ] |
Official Symbol : | UBE2D2 |
Synonyms : | UBE2D2; ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D2; UBC4; UbcH5B; |
Gene ID : | 7322 |
mRNA Refseq : | NM_003339 |
Protein Refseq : | NP_003330 |
MIM : | 602962 |
Uniprot ID : | P62837 |
Chromosome Location : | 5q31.3 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function : | ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
UBE2D2-67H | Recombinant Human UBE2D2 Protein | +Inquiry |
UBE2D2-6052R | Recombinant Rat UBE2D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2D2-243H | Recombinant Human UBE2D2 Protein, His-tagged | +Inquiry |
UBE2D2-71H | Recombinant Human UBE2D2, His-tagged | +Inquiry |
UBE2D2-31647TH | Recombinant Human UBE2D2, His-tagged | +Inquiry |
◆ Lysates | ||
UBE2D2-588HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
UBE2D2-587HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionUBE2D2 works in tandem with other ubiquitin-proteasome system components, orchestrating protein degradation.
It facilitates the attachment of ubiquitin to target proteins, directing them to the proteasome for breakdown.
UBE2D2 plays a role in controlling the cell cycle by regulating the degradation of key cycle-related proteins.
Targeting UBE2D2 could offer new treatments for conditions involving protein misfolding and aggregation.
Altered UBE2D2 activity is linked with several diseases, including cancer and neurodegenerative disorders.
Genetic mutations in UBE2D2 can disrupt protein turnover, affecting various cellular functions and stability.
UBE2D2, a ubiquitin-conjugating enzyme, is vital for tagging proteins with ubiquitin, marking them for degradation.
Customer Reviews (3)
Write a reviewTrusted for research integrity, supports research consistency.
Outstanding accuracy, highly recommended for insights.
Efficient service, accelerates our research timelines.
Ask a Question for All UBE2D2 Products
Required fields are marked with *
My Review for All UBE2D2 Products
Required fields are marked with *
Inquiry Basket