Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human UBE2D2

Cat.No. : UBE2D2-30042TH
Product Overview : Tagged Recombinant Human UBE2D2.
  • Specification
  • Gene Information
  • Related Products
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 50mM HEPES, 100mM Sodium chloride, pH 8
Storage : Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : The sequence (minus the tag) is:MALKRIHKELNDLARDPPAQCSAGPVGDDMFHW QATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT RIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLC DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Sequence Similarities : Belongs to the ubiquitin-conjugating enzyme family.
Gene Name : UBE2D2 ubiquitin-conjugating enzyme E2D 2 [ Homo sapiens ]
Official Symbol : UBE2D2
Synonyms : UBE2D2; ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D2; UBC4; UbcH5B;
Gene ID : 7322
mRNA Refseq : NM_003339
Protein Refseq : NP_003330
MIM : 602962
Uniprot ID : P62837
Chromosome Location : 5q31.3
Pathway : Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function : ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
How does UBE2D2 interact with other components of the ubiquitin-proteasome system? 02/19/2023

UBE2D2 works in tandem with other ubiquitin-proteasome system components, orchestrating protein degradation.

How does UBE2D2 contribute to cellular protein degradation? 12/27/2020

It facilitates the attachment of ubiquitin to target proteins, directing them to the proteasome for breakdown.

What role does UBE2D2 play in cell cycle regulation? 11/09/2019

UBE2D2 plays a role in controlling the cell cycle by regulating the degradation of key cycle-related proteins.

What potential therapeutic applications arise from targeting UBE2D2 in diseases related to protein misfolding? 11/24/2018

Targeting UBE2D2 could offer new treatments for conditions involving protein misfolding and aggregation.

What is the impact of altered UBE2D2 activity on disease development? 06/22/2017

Altered UBE2D2 activity is linked with several diseases, including cancer and neurodegenerative disorders.

How do genetic variations in UBE2D2 affect cellular homeostasis? 06/12/2017

Genetic mutations in UBE2D2 can disrupt protein turnover, affecting various cellular functions and stability.

What is the primary role of UBE2D2 in protein ubiquitination? 03/14/2017

UBE2D2, a ubiquitin-conjugating enzyme, is vital for tagging proteins with ubiquitin, marking them for degradation.

Customer Reviews (3)

Write a review
Reviews
07/12/2022

    Trusted for research integrity, supports research consistency.

    10/24/2020

      Outstanding accuracy, highly recommended for insights.

      12/30/2017

        Efficient service, accelerates our research timelines.

        Ask a Question for All UBE2D2 Products

        Required fields are marked with *

        My Review for All UBE2D2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends