Recombinant Human UBE2D3

• Cat.No.: UBE2D3-30045TH
• Product Overview: Recombinant Full Length Human UBE2D3 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-147; 147 amino acids, 16.7kDa,

Specification

• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGP NDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNI NSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPD DPLVPEIARIYKTDRDKYNRISREWTQKYAM
• Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family.

Gene Information

• Gene Name: UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens ]
• Official Symbol: UBE2D3
• Synonyms: UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C
• Gene ID: 7323
• mRNA Refseq: NM_003340
• Protein Refseq: NP_003331
• MIM: 602963
• Uniprot ID: P61077
• Chromosome Location: 4q24
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem
• Function: ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding