Recombinant Human UBE2S, His-tagged

• Cat.No.: UBE2S-26459TH
• Product Overview: Recombinant fragment, corresponding to amino acids 24-222 of Human E2 EPF with N terminal His tag; Predicted MWt 22 kDa.

Specification

• Description: This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 86 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMK LLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKR DWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLE NYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEA SSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
• Sequence Similarities: Belongs to the ubiquitin-conjugating enzyme family.

Gene Information

• Gene Name: UBE2S ubiquitin-conjugating enzyme E2S [ Homo sapiens ]
• Official Symbol: UBE2S
• Synonyms: UBE2S; ubiquitin-conjugating enzyme E2S; ubiquitin-conjugating enzyme E2 S; E2 EPF; ubiquitin carrier protein; ubiquitin conjugating enzyme E2 24 kD; ubiquitin protein ligase
• Gene ID: 27338
• mRNA Refseq: NM_014501
• Protein Refseq: NP_055316
• MIM: 610309
• Uniprot ID: Q16763
• Chromosome Location: 19q13.43
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem
• Function: ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; ubiquitin-protein ligase activity