Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human USP7, His-tagged

Cat.No. : USP7-29182TH
Product Overview : Recombinant fragment, corresponding to amino acids 907-1102 of Human HAUSP / USP7 with N terminal His tag; 196 amino acids, 29kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Ubiquitin-specific-processing protease 7 (USP7) also known as ubiquitin carboxyl-terminal hydrolase 7 or herpesvirus-associated ubiquitin-specific protease (HAUSP) is an enzyme that in humans is encoded by the USP7 gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Widely expressed. Overexpressed in prostate cancer.
Form : Lyophilised:Reconstitute with 146 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVS YKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDK ENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMK RIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKD FEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKI HN
Sequence Similarities : Belongs to the peptidase C19 family.Contains 1 MATH domain.
Gene Name : USP7 ubiquitin specific peptidase 7 (herpes virus-associated) [ Homo sapiens ]
Official Symbol : USP7
Synonyms : USP7; ubiquitin specific peptidase 7 (herpes virus-associated); HAUSP, ubiquitin specific protease 7 (herpes virus associated); ubiquitin carboxyl-terminal hydrolase 7;
Gene ID : 7874
mRNA Refseq : NM_003470
Protein Refseq : NP_003461
MIM : 602519
Uniprot ID : Q93009
Chromosome Location : 16p13.3
Pathway : FoxO family signaling, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; p53 pathway, organism-specific biosystem;
Function : cysteine-type endopeptidase activity; p53 binding; peptidase activity; protein C-terminus binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
Does USP7 interact with specific protein substrates? 12/02/2022

Yes, USP7 interacts with various protein substrates, including p53, MDM2, and PTEN, influencing their stability and cellular functions.

Can USP7 inhibitors be potential cancer therapeutics? 08/04/2022

Inhibitors targeting USP7 are being explored as potential cancer therapeutics, aiming to disrupt the stability of oncogenic proteins and inhibit cancer cell growth.

Does USP7 have tissue-specific expression patterns? 03/29/2021

USP7 exhibits tissue-specific expression patterns, and its levels may vary in different tissues and cell types.

What is the significance of USP7 in neurodegenerative diseases? 02/03/2020

USP7 has been implicated in neurodegenerative diseases, and its dysregulation may contribute to protein aggregation and neuronal dysfunction.

Are there post-translational modifications of USP7? 06/17/2019

Yes, USP7 undergoes post-translational modifications, including phosphorylation and ubiquitination, which can regulate its activity and stability.

How does USP7 regulate the p53 pathway? 04/24/2018

USP7 regulates the p53 pathway by deubiquitinating and stabilizing p53, preventing its degradation and promoting its transcriptional activity.

Is USP7 involved in the immune response? 02/18/2018

Yes, USP7 plays a role in the immune response by regulating the stability of proteins involved in immune signaling pathways.

Customer Reviews (3)

Write a review
Reviews
10/22/2021

    The product's widespread recognition among researchers made it a preferred choice for many scientific studies.

    06/17/2018

      Positive feedback from other labs and researchers confirmed its standing as a valuable research tool.

      06/28/2016

        The product's respected reputation in the scientific community was a testament to its quality and effectiveness.

        Ask a Question for All USP7 Products

        Required fields are marked with *

        My Review for All USP7 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends