Native Human VEGFA
Cat.No. : | VEGFA-31701TH |
Product Overview : | Human VEGF. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. |
Source : | E. coli |
Tissue specificity : | Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. |
Form : | Lyophilised:Reconstitute in 100ul dH2O |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | Human VEGF is a 38.2 kDa protein consisting of two 165 amino acid polypeptide chains:APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYI FKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRI KPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPC SERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERT CRCDKPRR |
Sequence Similarities : | Belongs to the PDGF/VEGF growth factor family. |
Gene Name : | VEGFA vascular endothelial growth factor A [ Homo sapiens ] |
Official Symbol : | VEGFA |
Synonyms : | VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF; |
Gene ID : | 7422 |
mRNA Refseq : | NM_001025366 |
Protein Refseq : | NP_001020537 |
Uniprot ID : | P15692 |
Chromosome Location : | 6p12 |
Pathway : | Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem; |
Function : | cell surface binding; chemoattractant activity; cytokine activity; cytokine activity; extracellular matrix binding; |
Products Types
◆ Recombinant Protein | ||
VEGFA-35H | Recombinant Human VEGFA Protein, Fc-tagged | +Inquiry |
VEGFA-261H | Active Recombinant Human VEGF-165 Protein | +Inquiry |
Vegfa-6915M | Active Recombinant Mouse Vegfa Protein | +Inquiry |
VEGFA-100R | Recombinant Rabbit VEGFA Protein | +Inquiry |
Vegfa-475M | Active Recombinant Mouse Vegfa protein(Met1-Arg190) | +Inquiry |
◆ Lysates | ||
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionStudies have shown that there is an association between the expression level of VEGFA protein and other biomarkers, for example, it can be associated with indicators such as tumor cell differentiation, metastatic capacity, and prognosis.
At present, a variety of drugs have been developed to target the VEGFA protein and its related signaling pathway, including inhibiting its expression and inhibiting its binding to receptors, etc., for the treatment of tumors and other vascular-related diseases.
VEGFA protein plays a key role in tumor angiogenesis, promoting tumor growth and metastasis by stimulating endothelial cell proliferation, migration, and vascular network formation.
The expression of VEGFA protein in different tissues and organs is different, and it is expressed in tumor tissue, cardiovascular system and other tissues and organs, and the expression level may be affected by many factors.
Studies have shown that the expression level of VEGFA protein is related to the degree of malignancy of the tumor, and the high expression of VEGFA protein often indicates that the tumor is more aggressive.
VEGFA protein plays an important role in cardiovascular disease by regulating endothelial cell function, promoting vascular repair and maintaining cardiovascular system homeostasis.
Customer Reviews (2)
Write a reviewVEGFA's catalytic activity is so strong that it can adapt even in the face of complex chemical reactions.
VEGFA they produced was highly active and the experimental effect was obvious.
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
Inquiry Basket