Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Native Human VEGFA

Cat.No. : VEGFA-31701TH
Product Overview : Human VEGF.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms.
Source : E. coli
Tissue specificity : Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.
Form : Lyophilised:Reconstitute in 100ul dH2O
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human VEGF is a 38.2 kDa protein consisting of two 165 amino acid polypeptide chains:APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYI FKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRI KPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPC SERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERT CRCDKPRR
Sequence Similarities : Belongs to the PDGF/VEGF growth factor family.
Gene Name : VEGFA vascular endothelial growth factor A [ Homo sapiens ]
Official Symbol : VEGFA
Synonyms : VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF;
Gene ID : 7422
mRNA Refseq : NM_001025366
Protein Refseq : NP_001020537
Uniprot ID : P15692
Chromosome Location : 6p12
Pathway : Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem;
Function : cell surface binding; chemoattractant activity; cytokine activity; cytokine activity; extracellular matrix binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
How does VEGFA protein relate to other biomarkers? 05/28/2022

Studies have shown that there is an association between the expression level of VEGFA protein and other biomarkers, for example, it can be associated with indicators such as tumor cell differentiation, metastatic capacity, and prognosis.

How to harness the activity of VEGFA protein for disease treatment? 05/14/2022

At present, a variety of drugs have been developed to target the VEGFA protein and its related signaling pathway, including inhibiting its expression and inhibiting its binding to receptors, etc., for the treatment of tumors and other vascular-related diseases.

What is the role of VEGFA protein in tumor angiogenesis? 09/24/2020

VEGFA protein plays a key role in tumor angiogenesis, promoting tumor growth and metastasis by stimulating endothelial cell proliferation, migration, and vascular network formation.

How well is the VEGFA protein expressed in different tissues and organs? 07/09/2020

The expression of VEGFA protein in different tissues and organs is different, and it is expressed in tumor tissue, cardiovascular system and other tissues and organs, and the expression level may be affected by many factors.

What is the relationship between the expression level of VEGFA protein and the degree of tumor malignancy? 03/26/2020

Studies have shown that the expression level of VEGFA protein is related to the degree of malignancy of the tumor, and the high expression of VEGFA protein often indicates that the tumor is more aggressive.

How about the fuction of VEGFA protein in cardiovascular disease? 01/10/2019

VEGFA protein plays an important role in cardiovascular disease by regulating endothelial cell function, promoting vascular repair and maintaining cardiovascular system homeostasis.

Customer Reviews (2)

Write a review
Reviews
04/21/2021

    VEGFA's catalytic activity is so strong that it can adapt even in the face of complex chemical reactions.

    03/09/2020

      VEGFA they produced was highly active and the experimental effect was obvious.

      Ask a Question for All VEGFA Products

      Required fields are marked with *

      My Review for All VEGFA Products

      Required fields are marked with *

      0

      Inquiry Basket

      cartIcon
      logo

      FOLLOW US

      Terms and Conditions        Privacy Policy

      Copyright © 2024 Creative BioMart. All Rights Reserved.

      Contact Us

      • /

      Stay Updated on the Latest Bioscience Trends