Recombinant Human XRCC5, His-tagged
Cat.No. : | XRCC5-29197TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 345-657 of Human Ku80 with an N terminal His tag. Predicted MWt: 37 kDa; |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events.This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 98 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHAL DDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYV QLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDS MSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALH PREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFP LIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHF SVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASN QLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQR FNN |
Sequence Similarities : | Belongs to the ku80 family.Contains 1 Ku domain. |
Gene Name : | XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ] |
Official Symbol : | XRCC5 |
Synonyms : | XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross |
Gene ID : | 7520 |
mRNA Refseq : | NM_021141 |
Protein Refseq : | NP_066964 |
MIM : | 194364 |
Uniprot ID : | P13010 |
Chromosome Location : | 2q35 |
Pathway : | 2-LTR circle formation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA-PK complex, organism-specific biosystem; |
Function : | contributes_to 5-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; double-stranded DNA binding; |
Products Types
◆ Recombinant Protein | ||
XRCC5-5046R | Recombinant Rhesus Macaque XRCC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
XRCC5-2646H | Recombinant Human XRCC5 protein(571-730 aa), C-His-tagged | +Inquiry |
XRCC5-10243M | Recombinant Mouse XRCC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
XRCC5-18639M | Recombinant Mouse XRCC5 Protein | +Inquiry |
Xrcc5-8229M | Recombinant Mouse Xrcc5 protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
XRCC5-254HCL | Recombinant Human XRCC5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket